KEGG   Ailuropoda melanoleuca (giant panda): 100466739
Entry
100466739         CDS       T01329                                 

Gene name
PROX1
Definition
(RefSeq) prospero homeobox protein 1 isoform X2
  KO
K20211  prospero homeobox 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100466739 (PROX1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with Prospero motifs
    100466739 (PROX1)
SSDB
Motif
Pfam: HPD NifQ Metal_resist
Other DBs
NCBI-GeneID: 100466739
NCBI-ProteinID: XP_002921008
Ensembl: ENSAMEG00000015776
UniProt: G1MBC1
Position
8
AA seq 737 aa
MPDHDSTALLSRQTKRRRVDIGVKRTVGTASAFFAKARATFFSAMNPQGSEQDVEYSVVQ
HADGEKSNVLRKLLKRANSYEDAMMPFPGATIISQLLKNNMNKNGGTEPSFQASGLSSTG
SEIHQEDICSNSSRDSPPECLSPFGRPTMSQFDMDRLCDEHLRAKRARVENIIRGMSHSP
SVALRGNENEREMAPQSVSPRESYRENKRKQKLPQQQQQSFQQLVSARKEQKREERRQLK
QQLEDMQKQLRQLQEKFYQIYDSTDSENDEDGNLSEDSMRSEILDARAQDSVGRSDNELC
ELDPGQFIDRARALIREQELAENKPKREGNNKERDHGPNSLQPEGKHLAETLKQELNTAM
SQVVDTVVKVFSAKPSRQVPQVFPPLQIPQARFAVNGENHNFHTANQRLQCFGDVIIPNP
LDTFGNVQMPSSTDQTEALPLVVRKNSSDQAASGPPAGGHHQPLHQSPLSATAGFTTSTF
RHPFPLPLMAYPFQSPLGAPSGSFSGKDRASPESLDLTRETTSLRTKMSSHHLSHHPCSP
AHPPSTAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSS
NMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCE
LYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSE
VPEIFKSPNCLQELLHE
NT seq 2214 nt   +upstreamnt  +downstreamnt
atgcctgaccatgacagcacagccctcttaagccggcaaaccaagaggagaagagttgac
attggagtgaaaaggacggtagggacagcatctgcattttttgctaaggcaagagcaacg
ttttttagtgccatgaatccccaaggttctgagcaggatgttgagtattcagtggtgcag
catgcagatggggaaaagtcaaatgtactccgcaagctgctgaagagggcgaactcgtat
gaagatgccatgatgccttttccaggagcaaccataatttcccagctgttgaaaaataac
atgaacaaaaatggtggcacggagcccagtttccaagccagcggtctctctagcacaggc
tccgaaatacatcaggaggatatatgcagcaactcttcaagagacagccccccagagtgt
ctttccccttttggcaggcctactatgagccagtttgatatggatcgcttatgtgatgag
cacctgagagcaaagcgcgcccgggtggagaatatcattcggggtatgagccattccccc
agtgtggcattaaggggcaatgaaaatgaaagagagatggccccgcagtctgtgagtccc
cgagaaagttacagagaaaacaaacgcaagcagaagctgccccagcagcagcaacagagt
ttccagcagctggtttcagcccgaaaagaacagaagcgagaggagcgccgacagctgaag
cagcagctggaggacatgcagaaacagctgcgccagctgcaggagaagttctaccaaatc
tatgacagcaccgattctgaaaatgacgaagatggcaacctgtctgaagacagcatgcgc
tccgagatcctggacgccagggcccaggactccgtggggcggtcagataatgagctgtgc
gagctggaccccggacagttcatcgaccgagcccgcgccctgatcagggagcaggagctg
gcggaaaacaagccgaagcgagaaggcaacaacaaagaaagagatcacgggccaaactcc
ttacaaccagaaggcaaacacttggccgagaccttgaagcaggaactgaacactgccatg
tcgcaagttgtggacactgtggtcaaagtcttttcagccaaaccctcccgccaggttcct
caggtcttcccgcctctccagatcccccaggccaggttcgccgtcaacggggagaaccac
aatttccacaccgccaaccagcgcctgcagtgctttggcgacgtcatcattccaaacccc
ctggacacctttggcaacgtgcagatgcccagctccacagaccagacagaagcactgccc
ctggtggtccgcaaaaactcctccgaccaggctgcctccggcccccccgccggcggccac
caccagcccctgcaccagtcgcctctctccgccaccgcgggcttcaccacgtccaccttc
cgccaccctttcccccttcccctgatggcctatccatttcagagtccattaggtgctccc
tccggctccttctcgggaaaagacagagcctctcctgaatccttagacttaactagggag
accacgagtctgaggaccaagatgtcatcccaccacctgagccaccatccttgttcacca
gcacacccacccagcaccgcagaagggctctccctgtcgctcatcaaatccgagtgcggc
gatcttcaagacatgtccgaaatctcaccttattcgggaagtgcaatgcaggaaggattg
tctcccaatcacttgaaaaaagcaaagctcatgttcttttatacccgttatcccagctca
aatatgctgaagacctacttctccgatgtgaagttcaacagatgcattacctctcagctc
atcaagtggtttagcaatttccgtgagttttactacattcagatggagaagtacgcgcgt
caagccatcaacgatggagtcaccagtaccgaagagctgtctataaccagagactgtgag
ctgtacagggctctgaacatgcactacaataaagcaaatgactttgaggttccagagaga
ttcctggaagttgcgcagatcacattacgagagtttttcaatgccattatcgcaggcaaa
gatgttgatccttcctggaagaaggccatatacaaggtcatctgcaagctggatagtgaa
gtccctgagattttcaaatccccgaactgcctacaagagctgcttcatgagtag

DBGET integrated database retrieval system