KEGG   Ailuropoda melanoleuca (giant panda): 100467069
Entry
100467069         CDS       T01329                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2 isoform X1
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04144  Endocytosis
aml04218  Cellular senescence
aml04350  TGF-beta signaling pathway
aml04371  Apelin signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04659  Th17 cell differentiation
aml04926  Relaxin signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05142  Chagas disease
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05321  Inflammatory bowel disease
aml05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100467069 (SMAD2)
   04390 Hippo signaling pathway
    100467069 (SMAD2)
   04371 Apelin signaling pathway
    100467069 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100467069 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    100467069 (SMAD2)
   04218 Cellular senescence
    100467069 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100467069 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100467069 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100467069 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100467069 (SMAD2)
   05205 Proteoglycans in cancer
    100467069 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100467069 (SMAD2)
   05212 Pancreatic cancer
    100467069 (SMAD2)
   05225 Hepatocellular carcinoma
    100467069 (SMAD2)
   05226 Gastric cancer
    100467069 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100467069 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100467069 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100467069 (SMAD2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100467069 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100467069 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100467069
NCBI-ProteinID: XP_019654017
Ensembl: ENSAMEG00000012816
UniProt: D2H8K9
Position
14
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQMNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccaccggttgtgaaaaggctgctgggatggaagaaa
tcagccggtgggtctggaggagcaggcggaggagagcagaacggacaagaagaaaagtgg
tgtgagaaagcagttaaaagtttggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaaatgtgtcaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctctggatggccgtctacaagtgtctcatcgg
aaaggactgccacacgtgatatattgccgattgtggcgctggcctgaccttcacagtcac
catgagctcaaagcaatcgaaaactgcgaatatgcttttaaccttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagttgagacaccagttctgcctccggtactggtg
ccgcggcatactgagatcctgacagaactgcctcctctggatgattatacccactccatt
ccagaaaacactaatttcccagcgggaattgagccacagagtaattacatcccagaaaca
ccgcctcctggatatatcagtgaggatggagaaacaagtgatcaacagatgaaccaaagt
atggatacaggatctccagcagaactatctcctactactctttcccccgttaatcatagt
ttggatttgcagccagttacttactcagaacctgcattttggtgttcaatagcatattat
gaattaaaccagagggttggcgagaccttccatgcatcacagccctccctcactgtagac
ggtttcacagacccatccaattcagagaggttctgcctagggttgctctccaacgtcaac
cgaaatgcgactgtagaaatgacaagaagacatataggaagaggcgtgcgcttatattac
ataggtggggaagtttttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aactgtaatcagagatacggctggcaccccgcaacagtgtgtaaaattccaccaggctgt
aacctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtctgttaatcag
ggtttcgaagccgtgtatcagctaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcagaataccgaaggcagacagtaacgagcactccttgctggattgagctt
catctgaatggacccctacagtggttggacaaagtattgactcagatgggatccccttca
gtgcgttgctcgagcatgtcataa

DBGET integrated database retrieval system