KEGG   Ailuropoda melanoleuca (giant panda): 100467094Help
Entry
100467094         CDS       T01329                                 

Gene name
ANGPT2
Definition
(RefSeq) angiopoietin 2
  KO
K05466  angiopoietin 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04066  HIF-1 signaling pathway
aml04151  PI3K-Akt signaling pathway
aml05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100467094 (ANGPT2)
   04015 Rap1 signaling pathway
    100467094 (ANGPT2)
   04010 MAPK signaling pathway
    100467094 (ANGPT2)
   04066 HIF-1 signaling pathway
    100467094 (ANGPT2)
   04151 PI3K-Akt signaling pathway
    100467094 (ANGPT2)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100467094 (ANGPT2)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100467094 (ANGPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C Spc29
Motif
Other DBs
NCBI-GeneID: 100467094
NCBI-ProteinID: XP_002923447
Ensembl: ENSAMEG00000005292
UniProt: D2HM16
Position
Un
AA seq 495 aa AA seqDB search
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGRRQYQVQQGACSYTFLLPETDNCRSSSSYV
PNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKREMVELQQNAVQNQT
AVMIEIGTNLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEI
NKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNN
SVLQKQQHDLMETVHNLLTLISTSNSAKYSFDVKEEKVIFRDCAEVFKSGRTTNGIYTLT
FPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQKTWQEYKLGFGKPSGEHWLGNEFVF
QVTNQQPYMLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLNGLTGTAGKISSISQPGN
DFTTKDVDNDKCICKCSQMLSGGWWFDACGPSNLNGMYYPQKQNTNKFNGIKWYYWKGSG
YSLKATTMMIRPADF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagattgttttctttactttgagctgtgatcttgtcctagccgcagcctataac
aactttcggaaaagcatggacagcatcgggagaaggcagtatcaggttcagcagggagcc
tgcagctacactttccttctgccggagacagacaactgtcgctcctctagctcctatgtg
cccaatgccgtgcagagggacgcaccactagattacgatgactcggtgcagaggctgcaa
gtgctggagaacatcatggaaaacaacactcagtggctaatgaagctcgagaattacatc
caggacaacatgaagagagaaatggtagagctgcaacagaacgcagtacagaaccagact
gcggtgatgatagagatagggacaaacctgctcaatcaaacagcagcgcagacacggaag
ttgacagacgttgaagcacaagtattaaatcagacaacaagacttgaacttcagcttctg
gaacattccctttccaccaacaaattggaaaaacagattttggatcagaccagtgaaatt
aacaaattgcaagataagaacagtttcctggaaaagaaagtactagacatggaagacaag
catatagttcaactacggtcaataaaagaagagaaagatcagctccaggtgttagtatcc
aagcaaaattccatcattgaagaactagaaaaacaactggtgaccgccacagtgaataat
tcggttctccaaaagcagcaacatgatctgatggagacagttcataatttattgaccctg
atatcaacgtcaaactcagccaagtactcctttgatgttaaggaagagaaagtcattttc
agagactgtgcggaagtattcaagtcaggacggacgaccaacggcatctacacgctcaca
ttccctaattccacagaggagatcaaggcatactgcgacatggaaacctctggaggcggg
tggacggtcattcagcggcgtgaagatggcagtgttgattttcagaagacttggcaagaa
tataaactgggatttgggaagccttccggcgaacactggctgggaaatgaatttgttttc
caagtgaccaatcaacagccctacatgcttaaaatacaccttaaagactgggaggggaac
gaggcgtactcactgtatgaacatttctatctctccggtgaagaactcaattacaggatt
caccttaacggacttacagggacggccggcaaaataagcagcataagccaaccaggaaat
gattttaccacaaaggatgtagacaacgacaaatgtatttgcaaatgttcacaaatgctc
tcaggaggctggtggtttgatgcgtgcggtccctccaacctgaacggaatgtactaccca
cagaagcagaacacaaacaagttcaacggcattaagtggtactactggaaaggctcaggc
tactcgctcaaggccacgaccatgatgatccgaccagcagatttctag

DBGET integrated database retrieval system