KEGG   Ailuropoda melanoleuca (giant panda): 100467178Help
Entry
100467178         CDS       T01329                                 

Gene name
BACH2
Definition
(RefSeq) BTB domain and CNC homolog 2
  KO
K09042  transcription regulator BACH
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100467178 (BACH2)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, NF-E2
    100467178 (BACH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB bZIP_Maf bZIP_1 bZIP_2 KASH_CCD DUF3342
Motif
Other DBs
NCBI-GeneID: 100467178
NCBI-ProteinID: XP_002925137
Ensembl: ENSAMEG00000003595
UniProt: D2HRF7
Position
Un
AA seq 841 aa AA seqDB search
MSVDEKPDSPMYVYESTVHCTNILLGLNDQRKKDILCDVTLIVERKEFRAHRAVLAACSE
YFWQALVGQTKHDLVVSLPEEVTARGFGPLLQFAYTAKLLLSRENIREVIRCAEFLRMHN
LEDSCFSFLQTQLLNSEDGLFVCRKDAACQRPHEDRENSAGEEEEEEEETMDSETAKMAC
PRDQMLPDPSSFEASAIPVAEKEQALLPESDVPADTKESSEKDALTQYPRYKKYQLACTK
NVYSAASHSTSGFASTFSEENSSNSLKPGLAVGQIKSEPPSEENEEESITLCLSGDEPDS
KDRAGDVEMDRKQPSPAPGPAPAAGATCLERSRSVSSPSCLRSLFSIKNSVELSGLPSTS
QQHFARSSACPFDKGITQGDLKTDYAPFLGNYGQPHLGQKDVSNFTTGSPLKGPGLEALC
KQEGELDRRSVIFSSSACDQVSSAVHSYSGVSGLDKDLSEPVPKGLWVGAGQSLPSAQAY
AHGGLMADHLPGRMRPNTSCPVPIKVCPRSPPLETRTRTSSSCSSYSYAEDGSGGSPCSL
PLCEFSSSPCSQGARFLATEHQEPGLMGDGMYNQVRPQIKCEQSYGTNSSDESGSFSEAD
SESCPVQDRGQEVKLPFPVDQITDLPRNDFQMMIKMHKLTSEQLEFIHDVRRRSKNRIAA
QRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNQLKACMGELLDNFSCLSQEVCRDIQSP
EQIQALHRYCPVLRPMGLPAASSINPTPLGVEQNLAASQCAVGESAPCCLEPGAAPPGPP
WAPGSAPENCTSARRPDGAEPGTFSERAPPLESRSQTVTVDFCQEMTDKCTTDEQPRKEY
T
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtggatgagaagcctgactcccccatgtatgtgtatgagtccacagtccactgc
accaacatcctgctgggtctcaatgaccagcggaaaaaggatattctctgtgacgtgact
ctgatcgtggagaggaaagagttccgggcccaccgggctgtgctggccgcatgcagtgaa
tacttctggcaggcgctggttggacagacgaagcatgacttggtggtcagcttgcctgaa
gaggtcacggccaggggctttgggcctctgttacagtttgcctacaccgccaagctatta
ctcagcagagaaaacatccgcgaggtcatccgctgtgctgagttcctgcgcatgcacaac
ctggaggactcctgcttcagcttcctgcagacccagctcctgaacagcgaggatggcctg
ttcgtgtgccggaaggacgctgcgtgccagcgcccgcacgaggaccgggagaactccgcc
ggagaggaggaggaggaagaggaggagacgatggactcagagaccgccaagatggcgtgc
cccagggaccagatgcttccagaccccagcagctttgaggcctccgccatccccgtagcc
gagaaggagcaagctttgctgcccgagtccgatgtgccggccgacaccaaggagagctcc
gaaaaggacgcgttaacgcagtaccccagatacaagaaataccagcttgcatgtaccaag
aatgtctacagcgcagcatcacacagtacctcaggttttgcaagcacattcagtgaagag
aactccagcaacagcctcaagccggggcttgccgtggggcagattaaaagtgaaccgccc
agtgaggagaacgaggaagagagcatcacactctgcctgtccggagatgagcctgacagc
aaggacagagccggggatgtggaaatggaccggaaacagcccagccccgccccaggcccc
gccccagccgccggagccacctgcctggagagatccaggagcgtgtcctccccctcctgt
ttaaggtctctgttcagcataaaaaatagcgtggagttgtctggcctgcccagtacctct
cagcagcactttgccaggagttcagcgtgcccttttgacaaggggatcactcagggtgac
cttaaaactgactacgcccctttcctggggaattacggacagccccacctgggccagaag
gacgtgtccaacttcaccacggggtcgcccctcaaggggcctgggttggaggctctctgt
aaacaggaaggagagctggaccggagaagtgtgatcttctcctcgagcgcttgtgaccaa
gtgagctctgcggtgcattcgtactctggggtaagcggtttggacaaagacctctctgag
ccggtgccaaagggtctgtgggtgggggctggccagtccctacccagcgcacaggcctac
gcccacggtgggctgatggctgaccatttgccaggaaggatgcggcccaacactagctgc
ccggtgccaatcaaagtgtgccctcgctcgccccccttggagaccaggaccaggacttcc
agctcttgctcctcctactcctacgcagaggacggaagcgggggctcaccctgcagcctc
cctctctgtgagttctcctcctcgccctgttcccagggagccagattcctagccacagag
catcaggaaccaggcctgatgggagatggaatgtacaaccaagtccgaccccaaattaaa
tgtgagcagtcttatggaaccaactccagcgacgaatccggatcgttctcggaagcagac
agtgagtcgtgtcctgtgcaggacaggggccaggaggtcaaacttccctttcctgtagat
caaatcacagatcttccaaggaacgatttccagatgatgattaagatgcacaagctaacc
tcagaacagttagagttcattcacgacgtgcgacggcgtagcaagaaccgcatcgcagcc
cagcgctgccgcaagaggaaactggactgtattcagaatttagaatgtgaaatccgcaaa
ctggtgtgtgagaaagagaagctgttgtcagagaggaaccaactgaaagcctgcatgggg
gagctgctggacaacttctcctgcctttcccaggaggtctgccgcgacatccagagccct
gagcagatccaggccctgcaccgctactgccccgtcctcagacccatgggcctccccgcg
gcctccagtattaaccccacgcccttgggcgtcgagcagaacctggccgcctcacagtgt
gcggtgggggaaagcgcgccctgctgcttggagcccggcgcggctccccccggccccccc
tgggcccccggcagcgccccggagaactgtacttccgcgaggaggccggatggcgctgaa
ccgggaaccttctcggagagggcgcctcctcttgaatccaggagccagacggtgaccgtg
gacttctgccaggagatgactgacaagtgtacaactgacgagcagcccaggaaagagtac
acctag

DBGET integrated database retrieval system