KEGG   Ailuropoda melanoleuca (giant panda): 100467254Help
Entry
100467254         CDS       T01329                                 

Gene name
BLVRB
Definition
(RefSeq) biliverdin reductase B
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00740  Riboflavin metabolism
aml00860  Porphyrin and chlorophyll metabolism
aml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    100467254 (BLVRB)
   00860 Porphyrin and chlorophyll metabolism
    100467254 (BLVRB)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     100467254 (BLVRB)
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     100467254 (BLVRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD
Motif
Other DBs
NCBI-GeneID: 100467254
NCBI-ProteinID: XP_002923744
Ensembl: ENSAMEG00000012457
Position
Un
AA seq 206 aa AA seqDB search
MAVKKIAIFGATGRTGLTTLAQAVQAGYEVTVLVRDASRLPPEGPQPAHVVVGDVLQAAD
VDKTVAGQDAIIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTK
VPPRLQDVTDDHIRMHKVLQESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHD
LGHFMLSCLTTDKYDGHNTYPSHQYE
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcaagaagattgccatcttcggcgccacgggcaggaccgggctcaccaccctg
gcgcaggcggtgcaagcaggttatgaggtgacagtgctggtgcgagacgcctccaggctg
cccccagaggggccccagccggcccacgtggtggtgggtgacgttctgcaggcggccgat
gtagacaagaccgtagctgggcaggatgccatcatcgtgctgctgggcacccgcaatgac
ctcagtcctaccacagttatgtccgagggcgcccggaacattgtggcggccatgaaggcc
catggcgtggacaaggtcgtggcctgcacctcggccttccttctgtgggacccgaccaag
gtgcctccacgactgcaggatgtgaccgatgaccacatccggatgcacaaggtgctgcag
gaatcgggcttgaagtacgtggccgtgatgccaccacacataggagaccagccgctgacg
ggggcctacacggtgaccctggatggacgagggccctccagggtcatctccaaacatgac
ctgggccacttcatgctgagctgcctcaccaccgataagtacgacgggcacaacacctac
ccctcccaccagtacgaatag

DBGET integrated database retrieval system