KEGG   Ailuropoda melanoleuca (giant panda): 100467495Help
Entry
100467495         CDS       T01329                                 

Gene name
DHCR7
Definition
(RefSeq) 7-dehydrocholesterol reductase
  KO
K00213  7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00100  Steroid biosynthesis
aml01100  Metabolic pathways
Module
aml_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    100467495 (DHCR7)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     100467495 (DHCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG4_ERG24
Motif
Other DBs
NCBI-GeneID: 100467495
NCBI-ProteinID: XP_002922249
Ensembl: ENSAMEG00000007479
Position
Un
AA seq 475 aa AA seqDB search
MAAKSLHDAPKTKSPGSIANSRAATQGQWGRAWEVDWFSLASVIFLLLFAPFIVYYFIMA
CDQYSCSLTAPALDIATGRARLSDIWAKTPPLTKKAAQLYTLWVTFQVLLYVALPDFCHK
FLPGYVGGVQEGAVTPAGIVNKYEINGLQAWLITHLLWFANSHFLSWFSPTIIFDNWIPL
LWCANVLGYAVSTFAMLKGYFFPTNAKDCKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFN
GRPGIVAWTLINLSFAAKQRELHGQVTNAMVLVNVLQAIYVLDFFWNEAWYLKTIDICHD
HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSAPHAAGVLLLGLLGYYVFRMANHQKDL
FRRTDGRCLIWGKKPKVIECMYTSADGQKHHTKLLVSGFWGVARHLNYTGDLMGSLAYCL
ACGGGHLLPYFYIIYMAILLTHRCLRDEHRCANKYGGDWERYTAAVPHRLLPGIF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaaatccctacatgacgctcctaaaaccaagagtccgggcagcatcgccaac
agcagagcggcgactcaagggcagtggggccgtgcctgggaggtggactggttctcgctg
gcgagcgtcatcttcctgttgctcttcgcacccttcatcgtgtactatttcatcatggcg
tgtgaccagtacagctgctctctgacggcccccgcgctggacatcgccaccgggcgtgct
cggctctcagacatctgggccaagacgccacctttgacgaagaaagcagcccagctctac
accctgtgggtcacgttccaggtgcttttgtacgtggcccttcctgacttctgccacaag
ttcctgccaggctacgtgggaggcgttcaagagggtgccgtgacccccgcaggcatcgtc
aacaagtatgaaatcaatggcctacaagcttggcttatcacgcaccttctctggtttgca
aactcgcacttcctgtcctggttctcgcccaccatcatcttcgacaactggatccccctg
ctgtggtgcgccaacgtccttggctacgccgtctccaccttcgccatgctcaagggctac
ttcttccccaccaatgccaaagactgcaaattcacaggcaatttcttttacaactacatg
atgggcattgagttcaacccccgaattgggaagtggtttgacttcaagctgttcttcaat
ggacgccctgggatcgtcgcctggaccctcatcaacctgtcctttgcggccaagcagcgg
gagctccatggccaagtgaccaacgccatggtcctggtcaacgtcctgcaggccatctat
gtgctggacttcttctggaacgaagcctggtacctgaaaaccattgacatctgccacgac
cacttcgggtggtacttgggctggggggactgcgtctggctgccatatctctacacgctg
cagggcctgtacctggtctaccacccggtgcagctgtcggcgccccacgccgcgggcgtc
ctgctgcttggcctgctgggctactacgttttccggatggccaaccaccagaaggacctg
ttccgccgcacggacggccgctgcctgatctggggcaagaagcccaaggtcatcgagtgc
atgtacacgtcggccgacgggcagaagcaccacaccaagctcctggtgtcgggcttctgg
ggcgtggcccgccacctcaactatacgggcgacctgatgggcagcctggcgtactgcctg
gcctgcggcgggggccacctgctgccctatttctacatcatctacatggccatcctgctg
acccaccgctgcctccgggacgagcaccgctgtgccaacaagtacggcggcgactgggag
cgctacactgccgccgtgccccaccgcctgctgccgggaatcttctga

DBGET integrated database retrieval system