KEGG   Ailuropoda melanoleuca (giant panda): 100467596Help
Entry
100467596         CDS       T01329                                 

Gene name
ESPL1
Definition
(RefSeq) extra spindle pole bodies like 1, separase
  KO
K02365  separase [EC:3.4.22.49]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100467596 (ESPL1)
   04114 Oocyte meiosis
    100467596 (ESPL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100467596 (ESPL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aml01002]
    100467596 (ESPL1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100467596 (ESPL1)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     100467596 (ESPL1)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C50: separase family
   100467596 (ESPL1)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    100467596 (ESPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 100467596
NCBI-ProteinID: XP_019659374
Ensembl: ENSAMEG00000012346
UniProt: D2HLP9
Position
Un
AA seq 2108 aa AA seqDB search
MRSFKGINFGTLLSNPKEAEELLPDLKEFLSKLPAGSPSCRSDAERRQACDAILRACNQQ
LMAKLACPKHLGSLLDLAELACNGYLVFTPQRSPLYLERILFIFLRNIATQGIPEATLRF
AQPLHACLVQCSRQAAPQDYEAVARGSFSLLWKVAEALEERRAALSARLKALSFLVLLED
ESTPCEVPHFASPTACRVVAAHQLFDATGHGLNEADADFLGDLLSSHVIRALVDEGGGSP
GPLSPQRALCLLELTLEHCRRLCWSCHHAKATRVVEKAHDYLRNTNLAPSLQLCRLGVEL
LQTGEGGPQALAKLLIKASAILNNSVEAPSPPLRALCDSCQFFLSCLERGIKRRYGPDAV
LGLFAFLGGYFSLLRLLQDGVCGDSSKQQQSLVQMHFQGLHLYTLVVYDFAQNCQVADVA
DLAQLVESCKSTVVWMLEALQSLSGQELTDYLGMTASYTSNLAYGFYSHQLYAEACAISE
PLCQHLGMAKPGTHPKVPPEKLHRCFRLRGESLKKLGKQAQGCKMVSLWLAALQPCGPQH
MAEPVTFWVRVKMDAAKAGDKELQLRTLRDSLSGWDPETLVFLLREELQAYKAVRADTGQ
ERFNIICDLLELSPEETPAGAWARATHLVELAQVLCYHDFAQQTNCSALDAVQEALQLLE
CVQPEPRARAQLLDDQAQALLWLFICTLEARVQEGIERDRRAQAPNNLEEFEVNDLNYED
KVQEDRFLYSNIAFNLAADAAQSKCLDQALALWKEVLTKMQAPAVRCLQQTVASLQTLAA
LYQLAAKPLQALEVHLLVRIVSQRLEDHAKAAGSSCHAAQLLLTLGCPSYAQLHLEEADS
SLKLLDHTTDTYLLLSLTCDLLRSQLYCVHQKVTEGASLLLSVLRDPALQRPSKAWYLLR
VQALQLVAFYLSLSSDSLSASLREQLCAQGWQTPEIALIDSHKLLRSIILLLMGSDVLSI
QKSAVETPFLDFGENLVQKWQVLTEVLSCSEKLVSHLGRLGSVSEAKAFCLEALKLTTKL
QMPRQCALFLVLKAELELARNDIDLCQSDLQQVLFLLESCTEFGGPAQDLDSVKKVHLQK
GKQQAQVHRPPELPEEEPFLRGPALELVATVAKEPGPVTPSTNSSPVLKMKPQPSPGFLT
HLPTCDCLLCASPVLSAVCLRWALVTAGVRLATGHEAQGLDLLQVVLKGCPAATERLTRA
LQTSLSHRAPPSPAPSLLDEILAQAYTQLALEGLSRPSNKSLGKVLESGLKFVAARVPHL
EPWRASLLLIRALVKLAGLNCCTGQLFASSWGWQPPPVKPSPGSEPSKPRSQKHSGRGRP
RAASSTPSLHNTSLKGLEGGGLPCTPKPPGQARQAGPRVPFTVFEEVLSTKSKPEVPKAP
RVQQRVQTRLKVSFSDDSDLEDPVSVEAQLAEEPKRRGTASRGRGRARKGSGLKTVSVAA
PDSAPGRPGLGGRSRRAKKVTSGHCEELGSEIMRTIPEEEMTDDQMEMSFEILRSSDGED
PTSGGKAPAPGPDTALGECEVLRRDSSKEELPIPCPDKERDKDPGPRLRPPSAPAAVGLS
TLNSICDLLTTALRGVSHCPPSGLYAQLCRFLALCLGHRDPYATACLVTESVSITCRHQL
LTHLHRQLSKAQRHRGSVDMADQLQRLSLEERPGDAPLARIQHLFSFGASGSGQFPEPEK
ESFRERLALLPSGVTVCVLALATLQPGTVGDTLLLTRLEKDNPPVTVQIPTAQNKLPLSS
ALKEFDAIQKEQKENSSCTDKREWWTGRLELDQRMEVLITSLEKHVLGCWRGLLLPSSED
PGPAQEASHLQKLLQECGWKYPDPTLLKSMLSGASTLTPQDVQTLAYGLCPARPERAQEL
LSEAVGRLRGQAVPSKKHLVLVLDKDLQKLPWESMPSLRALPVTRLPSVHFLLSYSVIKE
SGASSVLSHGVDPRNTFYVLNPHNNLASTEEQFRAHFSSEAGWKGVVGEVPSPEQVQAAL
TEHDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAALAVHGKLEGAGIVLKYIMA
GCPLFLGNLWDVTDRDIDRYTEALLQGWLGAGPGAPLLYYVSQARQAPRLKYLIGAAPVA
YGLPVCLR
NT seq 6327 nt NT seq  +upstreamnt  +downstreamnt
atgaggagcttcaaaggaatcaactttgggactttactaagcaacccgaaggaggctgaa
gaattgctgcctgacttgaaggagttcctgtccaagcttccggctggttcacccagctgc
cgatctgatgctgagaggagacaagcttgtgatgccatattgagggcttgcaaccagcag
ctgatggccaagctggcttgccctaagcacctggggagcctgctggacctggcagagctg
gcttgcaatggctacttggtgttcaccccccagcgctcaccgctctacctggaacgaatt
ctcttcatctttctgcggaacattgccacacagggaatcccagaggccacgctccgattt
gctcagcccctccatgcctgtttggtgcagtgctcccgccaagctgctccccaggactat
gaggctgtggctcgcggcagcttttctctgctttggaaggtggcagaagccctggaggag
aggcgagctgcactctcggctcggctgaaggccttgagctttctagtgctcttggaggat
gaaagtaccccttgtgaggttccccactttgcttctccaacagcctgtcgcgtggtagct
gcccatcagctattcgatgccactgggcatggtctgaatgaagcagatgctgatttccta
ggtgatctgctctccagtcatgtgatcagagccttggtggatgaaggagggggttctcct
ggtcctctttctccccagagggccctgtgtctcttggaactcaccctggaacactgccgt
cgcctctgctggagttgccaccatgccaaggccaccagggtagtggagaaggcccatgat
tacctaagaaacaccaatctggcccccagcctccagttatgccgccttggggttgaactg
ctacagactggggagggaggacctcaagcactggccaagcttttgatcaaagcatcagct
atcctgaacaacagtgtggaggcaccatcacccccgctgcgggcattgtgtgacagctgc
cagttcttcctctcatgcttggagcgaggcatcaagcggcgctatggacctgatgctgtt
ctgggcctctttgcttttcttggcgggtacttctctctcctccggctgctgcaggatggt
gtgtgtggggactcctccaagcagcagcagtctttagttcagatgcactttcagggactt
catctctacactctggtggtatatgactttgcacaaaactgtcaggtagctgatgtggct
gacctggctcagctagtggaaagttgcaaatctactgtggtctggatgctggaggcctta
cagagcctgtcaggccaagaactgactgattatctgggcatgactgcctcttacaccagc
aacttggcctacggcttctatagtcaccagctgtacgccgaggcctgcgccatctccgag
cccctctgtcagcacctgggcatggcgaagccgggcacgcaccctaaggtgcctcctgag
aagttgcacaggtgcttccggctacgtggagagagtttgaagaaactgggtaaacaggcc
cagggctgcaagatggtgagtttgtggctggcagccctgcagccctgtggcccccaacac
atggctgagccagtcaccttctgggttcgggtcaagatggacgcagccaaagcaggagac
aaggagctacagctgaggactctgcgagacagcctgagcggctgggacccggagaccctg
gtcttcctgctgagggaggagctgcaggcctataaggccgtgcgagcggacacggggcag
gagcggttcaacatcatctgtgacctgctggaactgagccctgaggagacaccggctggg
gcctgggctcgagccacccacctggtggaactggctcaggtgctctgctaccacgacttt
gcccagcagaccaactgctcggccctggatgctgtccaggaggccctgcagcttctggag
tgcgtgcagcccgagccccgggcccgggcgcagcttctggatgaccaggcccaggccctg
ctgtggctcttcatctgcacgctggaggccagggtgcaggagggtatcgagcgggatcgg
agagcccaggcccctaataacctggaggagtttgaagtcaatgacctgaactatgaagat
aaagtgcaggaagatcgcttcctatacagtaacatcgctttcaacctcgcggcagacgct
gctcagtccaaatgcctggaccaagccctggccctttggaaggaggtgcttacaaagatg
caggcgcccgccgtccggtgtctccagcagacagtggcctctctgcagaccctcgcagcc
ctctatcagctggcggcaaagcccctgcaggctctggaggtccacctgctcgtgcggatc
gtctcccagagattggaggaccacgcgaaggcagccggctcctcctgccacgccgcgcag
ctgctcctgacgctcggctgtcccagctatgcccagctacacctggaagaggcagactcg
agcctgaagcttctggatcacaccactgacacgtacctgctcctttccctgacctgtgac
ctacttcgaagtcaactctactgtgttcaccagaaggtgactgagggtgcctctctgttg
ctgtcagtgcttcgggaccctgccctccagaggccatccaaggcctggtatttgctgcgt
gtccaggccctgcagctggtggcattctaccttagtctctcatcagacagcctctcagcc
tccctgagagagcagctctgtgcccaaggctggcagacgcctgagatcgccctcatcgac
tcccataagctgctccggagcattattctcctgctcatgggcagcgatgtgctctcgatt
cagaagtcagctgtggagacaccatttctggacttcggtgaaaatctggtacaaaaatgg
caggttctgacagaggtgctgagctgctcggagaagctggtgtcccacctgggccgtctg
ggcagtgtgagcgaagccaaggccttttgcttggaggccctgaaactcacgacaaagctg
cagatgccacgccagtgcgccctgttcctggtgctgaaggcggagctggagctggctcgc
aacgacatcgacctctgtcagtcagacctgcagcaggttctgttcttgctcgagtcttgc
acagagtttggtggaccagcccaggacctggactctgtgaagaaggtccacctgcagaag
ggcaagcagcaggcccaggtccatcgtcctccggagcttccagaagaggagcccttccta
agaggccctgctctggagctggtagccactgtggccaaggagcctggccctgtaacacct
tctactaactcttcccctgtcctgaaaatgaagccccagcccagccccggcttcctgaca
cacctgcccacgtgtgactgcctgctctgtgccagccctgtcctctccgcggtctgtctg
cgttgggcattggtcacagcgggggtgaggctggccacgggccatgaggcccagggtctg
gatctgctgcaggtcgtgctgaagggttgccctgcagccactgagcgcctcacccgagct
ctgcaaacttccctgagtcacagagcacccccctcccctgccccgagcctcctggatgag
atcttggctcaggcctacacacagctggccctggaggggctgagccggccatcaaacaag
agcctggggaaggtcctggagtcagggctgaagtttgtggcagcgagggtcccccacctg
gagccctggcgggccagcctgctcttgatccgggcccttgtgaagctggctggcctcaac
tgctgcactggccaactttttgcaagctcctggggctggcagccaccccccgtaaaacca
tccccaggctcagagccctctaagcctcggagccaaaaacattctggaagaggacgtccg
cgggcggcctcttctaccccgtccctccataatacctctctgaaaggtctggaaggtgga
ggactgccctgtacacctaagcccccaggccaggccagacaagcaggccctcgtgtcccc
ttcactgtgttcgaggaagtcctctctacaaagagcaagcctgaggttcccaaggccccg
agggtacaacagagggtccagacgcgcctcaaggtgagtttcagtgacgacagtgacttg
gaagaccctgtctcagttgaggcacagcttgcagaggagcccaagagacggggcactgct
tcccggggccggggccgggccaggaagggctcaggcttgaagactgtttcggtggcagcc
ccggatagtgcccccgggcgacctggccttggtggcaggagccggagggccaagaaggtg
acatcaggacattgtgaggagctgggctctgagatcatgaggaccatccctgaggaggaa
atgactgacgaccagatggaaatgagctttgagatcctcaggagctctgacggggaagac
cccacctccggtgggaaagcaccagctccaggacctgatacggccctaggagaatgtgag
gtcttgaggcgtgattccagcaaagaggaactgcctatcccgtgcccagacaaggagaga
gacaaggatcccggtcctcggctccgacccccctcagcccctgcagctgtcggtctgtct
accctgaattccatctgtgacttactgaccactgctctccgtggggttagtcactgccct
cctagtgggctctatgctcaactctgccgcttcctggctttgtgcttgggccaccgggat
ccctacgccaccgcctgcctcgtcaccgagtctgtgtccatcacctgtcgccaccagctg
ctcacccacctccacaggcagctcagcaaggcccagaggcaccggggatcagtcgacatg
gcggaccagctgcagaggctgagcctggaggagaggcctggagatgcccccctggctcgc
atccagcacctcttttccttcggggcttcaggatctggtcaattccctgagcctgagaag
gagagtttccgggagcgcctggctctgctccccagcggggtgaccgtttgtgtgttggct
ctggccacgctccagcctggaactgtgggcgacaccctcctgctgacccggctggaaaaa
gacaatcccccagtcactgtgcagatccccactgcccagaacaagcttcctctgagttca
gccctgaaagagtttgacgccatccagaaggagcagaaagagaacagcagctgtactgac
aagcgagagtggtggacagggcggctagaactggaccaaaggatggaggttctcatcact
tccctagagaagcatgtgttgggctgctggaggggactgttgctgccatccagcgaggac
cctggccctgcccaggaggcctcccacctacaaaagttgctgcaggaatgtggctggaaa
taccccgacccaactctgctgaaaagcatgctcagtggcgccagtaccctcactcctcag
gacgttcagaccctggcctatgggctgtgcccagcgcggccagaacgagcccaagagctt
ctgagtgaggcagtaggacgtctgcggggtcaggcggtcccaagcaagaagcaccttgtc
ttagtgctagacaaggacctgcaaaagcttccgtgggagagcatgcccagcctccgggca
ctgcctgtcactcggctgccctccgtccatttcctgctcagctactccgtcatcaaagag
tctggggcctcgtcagtgctaagccacggggtggatccacgcaataccttctatgtcctg
aaccctcacaataacctggcaagcacagaggagcaatttcgagcccattttagcagtgaa
gctggctggaaaggggtggttggggaagtgccaagcccagaacaagtgcaggcggccttg
acggagcatgacttatatatctatgcagggcacggggctggtgcccgcttcctggatgga
caggctgtcctccgactgagctgccgggcggtggccctgctgtttggctgcagcagtgca
gccctggctgtgcacgggaagctggagggggctggcatcgtgctcaagtatatcatggca
ggctgtcccctgtttctgggtaacctctgggatgtgactgaccgtgacatcgatcgctac
acggaagctctgctgcagggctggcttggagcgggcccaggagccccccttctctactat
gtcagccaggcccgccaggctccccgactcaagtatcttattggggctgcacctgtggcg
tatggcttgcctgtctgcctgcgatga

DBGET integrated database retrieval system