KEGG   Ailuropoda melanoleuca (giant panda): 100468694Help
Entry
100468694         CDS       T01329                                 

Gene name
EP300
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04024  cAMP signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04310  Wnt signaling pathway
aml04330  Notch signaling pathway
aml04350  TGF-beta signaling pathway
aml04520  Adherens junction
aml04630  Jak-STAT signaling pathway
aml04720  Long-term potentiation
aml04916  Melanogenesis
aml04919  Thyroid hormone signaling pathway
aml04922  Glucagon signaling pathway
aml05016  Huntington's disease
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  HTLV-I infection
aml05167  Kaposi's sarcoma-associated herpesvirus infection
aml05168  Herpes simplex infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05206  MicroRNAs in cancer
aml05211  Renal cell carcinoma
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100468694 (EP300)
   04330 Notch signaling pathway
    100468694 (EP300)
   04350 TGF-beta signaling pathway
    100468694 (EP300)
   04630 Jak-STAT signaling pathway
    100468694 (EP300)
   04066 HIF-1 signaling pathway
    100468694 (EP300)
   04068 FoxO signaling pathway
    100468694 (EP300)
   04024 cAMP signaling pathway
    100468694 (EP300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100468694 (EP300)
  Cellular community - eukaryotes
   04520 Adherens junction
    100468694 (EP300)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    100468694 (EP300)
   04919 Thyroid hormone signaling pathway
    100468694 (EP300)
   04916 Melanogenesis
    100468694 (EP300)
  Nervous system
   04720 Long-term potentiation
    100468694 (EP300)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100468694 (EP300)
   05206 MicroRNAs in cancer
    100468694 (EP300)
   05203 Viral carcinogenesis
    100468694 (EP300)
   05211 Renal cell carcinoma
    100468694 (EP300)
   05215 Prostate cancer
    100468694 (EP300)
  Neurodegenerative diseases
   05016 Huntington's disease
    100468694 (EP300)
  Infectious diseases
   05152 Tuberculosis
    100468694 (EP300)
   05166 HTLV-I infection
    100468694 (EP300)
   05164 Influenza A
    100468694 (EP300)
   05161 Hepatitis B
    100468694 (EP300)
   05168 Herpes simplex infection
    100468694 (EP300)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100468694 (EP300)
   05169 Epstein-Barr virus infection
    100468694 (EP300)
   05165 Human papillomavirus infection
    100468694 (EP300)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100468694 (EP300)
Transcription factors [BR:aml03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100468694 (EP300)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100468694 (EP300)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100468694 (EP300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Motif
Other DBs
NCBI-GeneID: 100468694
NCBI-ProteinID: XP_002927072
Ensembl: ENSAMEG00000013940
UniProt: G1M5Y3
Position
Un
AA seq 2421 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQPQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSAAGMMNSPVNQPAMGMNTGMNAGMNPGMLN
AGSGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQIGAGGLGLQIQTKSVLPNNLSPFAMDKKAVPGGGM
PNMGQQQAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTSNLLSDSMLHSAINS
QNPMMSENASVASLGPMPTAAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQPGLNQFGQMS
MPQPPIGPRQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQTQFSTQGMNVTN
MPLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQSALHQNSPSPVPSRT
PTPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQTQALHPPPRQTPTPPPTQLPPQVQP
SLPAAPSADQPSQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSS
TEVNSQTIPEKQPSQEVKMEAKMEVDPPEPADAQPEDIPETKAEDCKMEPTETEERGAEL
KTETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPV
DPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY
KYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYH
FCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICV
LHHEIIWPSGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESG
EVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQ
EYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACP
PSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAK
ELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKN
KSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLI
PCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQGQDRFVYTCNECKHHVET
RWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNSQQAAATQSPGDSRRLSIQRCI
QSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQEN
KCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPT
GATPQTPQPQPPSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPG
PPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMTRGPSGHL
EPGMGPTGMQQQPQWVQGGLPQPQQLQPGMPRPAMMSVAQHGQPLNIAPQPGLGQVGVSP
LKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYASSNPQPL
AGQPGMPQGQPGLQPPAMPGQQGVHSSPAMPNMSPMQAGVQRAGLPQQQPQQPLQPPMGG
MSPQAQQMNMNHNAMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYP
PPPPPPPQPQQQRMQHHLQQMQPGSMGQMGQLPQALGAEAGAGLQAYQQRLLQQQMGSPA
QPNPMSPQQHMLPSQAQSPHLQGQQIPSSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQP
QPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQSSMLSQLASNPGMANLHGAGATDL
GLGPDNADLNSNLSQSTLDIH
NT seq 7266 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcttcggccagcgatggcacagattttggctctctatttgatttggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacaa
ctgtcagaattgctacggtctggtagttcccctaacctcaatatgggggttggtggccca
ggccaaggcatggccagccagccccaacagaacagtcctggattaggtttgataaatagc
atggttaaaagcccaatggcacaggcaggcttgacttctcccaacatggggatgggcacc
agtggaccaaatcaaggtcctacgccatctgcagcaggtatgatgaacagtccagtaaat
cagcctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttgaat
gcaggcagtggacaggggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgacctaatatgcagtacccaaacccaggcatgggaaatgctggcaacttaatg
acagagccactgcagcaaggctctcctcagatgggaggacaaacgggattgagaggccct
cagcctcttaagatgggaatgatgaacaaccctaatccttacggttcaccatacactcag
aattctggacagcagattggagccggtggccttggtctccagattcagacaaagtctgta
ctaccaaataacttatctccatttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaacatgggtcaacagcaggccccacaagtccagcagccaggcctagtgactccagtg
gcccaagggatgggttctggagcacatacagctgatccagagaagcgcaagctcatccag
cagcagcttgttcttcttttacatgctcataagtgccagcgccgggagcaggctaacggg
gaagtgaggcagtgcaaccttccccactgtcgcacaatgaagaacgtcctaaaccacatg
acacactgccagtcaggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcacactggaagaattgtacaaggcatgattgtcctgtgtgtctcccccttaaaaat
gctggagataagagaaatcagcaatcaattctgactggagcaccagttggacttggaaat
actagctccctaggtgtgggtcaacagtctacccctagcctaagcactgttagtcagatt
gatcccagctctatagaaagggcctatgcagctcttggtctgccctatcaagtaaatcag
atgccaacgcagccccaggtgcaagcaaagaaccagcagaatcagcaatctgggcagtct
ccccaaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcaaacgtcgaatcttctttctgactcaatgttgcattcagccataaattct
caaaacccaatgatgagtgaaaatgccagtgtggcctccctgggtcctatgccaacagca
gctcaaccatccaatactggaattcggaaacaatggcatgaagatattactcaggatctt
cgaaatcatcttgttcacaaacttgttcaagccatatttcctactccggatcctgctgct
ttaaaagacagacgaatggaaaacttagttgcatatgcccggaaagtggaaggggacatg
tatgaatctgcaaataatcgagcggaatactaccacttgctagctgagaagatctataag
atccagaaagaactagaagaaaaacgaaggactagactacagaaacaaaacatgctgccc
agtgctgcaggcatggtgccagtttctatgaatccagggcccaatatggggcagccacaa
ccaggaatgacttccaatggccctctacctgacccatctatgatccgcggcagtgtgcca
aaccagatgatgcctcggataactccacagcctggtttgaatcagtttggccagatgagt
atgccccagcccccaattggaccccggcaaacctctcctcttcagcaccatggacagtta
gctcagcctggaactctcaacccgcctatgggctatgggcctcgcatgcagcagccttcc
agccagagccagttccttccccagactcagttctcaacacagggaatgaatgtaacgaat
atgcctttggctccgtctggcggtcaagcaccagtgtctcaagcacaaatgtccagttct
tcctgcccagtgaactctcctataatgcctccagggtcgcaagggagccacattcactgt
ccccctctccctcaatcagctctgcatcagaattcaccctctccggtacctagtcgcacc
cctacgcctcaccacactcccccaagcataggggcccagcagccaccagcaacagcaatt
ccagcccctgttcctacacctccagccatgccccccgggccgcagacccaggctctacat
ccacctccaaggcagacacccacaccaccaccaacgcagcttcctcctcaagttcagcct
tcacttcctgctgctccttcggctgaccagccatcgcagcagcctctctcacagcagagc
accgcagcatctgttcccaccccgacggcgccgctgctgcccccacagcctgcgactcca
ctttcccaaccagctgtaagcattgaaggtcaggtatcaaatcctccatccactagtagc
acagaagtgaattctcagaccattcctgagaagcagccgtcacaggaagtgaaaatggag
gcaaagatggaagtggatccaccagaaccagcagatgctcagccagaggatattccagag
actaaagcagaagactgtaaaatggaacctacagaaacagaagagagaggggctgaatta
aaaactgaaacaaaagaggaggaagaccagccaagtacttctgctacacagtcttctcca
gccccgggacagtcaaagaagaagattttcaaaccagaagagttacgacaggcactgatg
ccaactttggaggcactttaccgacaggatccggaatccctaccctttcgtcaacctgtg
gaccctcaactcctaggaatccctgattattttgatattgtgaagagccccatggacctt
tctaccatcaagaggaagttagacactggacagtatcaggagccctggcagtatgtggat
gacatttggcttatgttcaacaatgcctggttgtataatcggaaaacatctcgggtatac
aaatactgctccaagctgtctgaagtctttgaacaagaaattgacccagtaatgcaaagc
ctcggatattgttgtggcagaaagttggagttctctccacagacactctgttgctatggc
aaacagttatgcacaatccctcgtgatgccacttactacagttaccagaacaggtatcat
ttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgaccct
tcccagcctcaaactacgataaataaagaacagttttccaagagaaaaaatgacacactg
gatcctgaattatttgttgaatgtacagagtgcggaagaaagatgcatcagatctgtgtt
cttcatcatgaaattatctggccatctggatttgtttgtgatggctgcttaaagaaatct
gcacgaaccaggaaagaaaataagttttctgctaaaaggttgccatctaccaggcttggc
acctttctagagaatcgtgtaaatgactttcttaggcgacaaaatcaccctgagtccgga
gaagtcactgttcgggtagttcatgcttctgacaaaactgtggaagtgaaaccaggcatg
aaagcaaggtttgtagatagtggagagatggcagaatcctttccgtaccgaaccaaagcc
ctctttgcctttgaagagatagacggtgttgacttgtgtttctttggcatgcacgttcaa
gagtatggctctgactgccctccacccaaccagaggagagtttacatatcataccttgac
agtgttcatttcttccgtcctaaatgcttgaggactgcagtctatcatgaaattctaatt
ggatatttagaatacgtcaagaaattagggtacacaacagggcatatttgggcttgtccc
ccaagtgagggagatgactatatcttccattgccatcctcctgaccagaagatacccaag
cccaagcgactgcaggagtggtacaaaaagatgcttgacaaggccgtgtctgagcgaatc
gtccatgactacaaggatatttttaaacaagcgactgaagatcgactaacaagcgcaaag
gagctgccttactttgagggcgatttctggcccaatgttctggaagagagcattaaggaa
ctggaacaggaggaggaagagcgaaagcgagaggagaacaccagcaacgagagcacagat
gtgacgaagggagacagcaaaaatgctaaaaagaaaaataataagaaaaccagcaaaaac
aagagcagcctgagtaggggcaacaagaagaagcccggcatgcccaatgtctccaacgac
ctctcccagaagctgtacgccacgatggagaagcacaaggaggtcttctttgtgatccgt
ctcatcgctggccctgccgccaactccctgcctcccatcgtcgatcccgaccccctcatc
ccctgcgatctgatggatgggcgggatgccttccttacccttgcaagggacaagcacctg
gagttctcctcactccgaagagcccagtggtccaccatgtgcatgctggtggagctgcac
acccagggccaggaccgcttcgtctacacctgcaatgagtgcaagcaccacgtggagacg
cgctggcactgcactgtctgcgaggattatgatctgtgtatcacctgctataacactaaa
aaccatgaccacaaaatggagaaactaggtctgggcttagatgatgagagcaacagccag
caggccgcagccacccagagcccgggggactcgcggcgcctgagcatccagcgctgcatc
cagtccctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccag
aagatgaagcgggtggtgcagcacaccaagggctgcaagcggaaaaccaacggcggctgc
cccatctgcaagcagctcatcgccctctgctgctaccacgccaagcactgccaggagaac
aagtgcccggtgcccttctgcctcaacatcaagcagaaactccggcagcagcagctgcag
caccggctccagcaggcccagatgctccgcaggaggatggccagcatgcagcggaccggt
gtggtggggcagcagcaaggcctgccctcccccactcctgccactcccaccacgccgacg
ggcgccaccccacagacgccccagccccagcctccctctcagcctcagcccacgcctccc
aacagcatgcccccctacttgcccaggactcaggctgctggccctgtctcccagggtaag
gcggcaggccaggtgacccctcccacacccccccagactgctcagccacccctcccgggg
cccccgcctgccgcagtggaaatggcaatgcagattcagagggcggctgagacgcagcgc
cagatggcccacgtgcaaatttttcaaaggccaatccagcaccagatgccccagatgact
ccaatggctcccatgggtatgaacccaccccctatgaccagaggtcccagtgggcatttg
gagccagggatggggcccacagggatgcagcagcagccacagtgggtccaaggagggttg
cctcagccccagcagctacagcccgggatgccgaggccagcaatgatgtcagtggcccag
cacggccagcccttgaatatagcaccccagccaggactgggccaggtaggtgtgagccct
ctcaaaccaggcactgtgtctcaacaagccttacaaaaccttttgcggactctcaggtct
cccagctctcccctacagcagcaacaggtgctcagtatccttcacgccaacccccagctg
ttggctgcattcatcaagcagcgggctgccaagtacgccagctcgaatccgcagcccctc
gctgggcagcccggcatgccccagggccagccggggctgcaaccacctgccatgccgggc
cagcagggcgtccactccagtccagccatgccgaacatgagccccatgcaagcgggcgtc
cagagggccggcctgccccagcagcagccgcagcagccgctccagccccccatgggaggg
atgagcccccaggctcagcaaatgaacatgaatcacaacgccatgccttcgcagttccga
gacatcttgcggcggcagcaaatgatgcagcagcagcagcagcagggagcggggcccggg
atcggccccgggatggccaaccataaccagttccagcaaccgcaaggggtgggctacccc
ccaccgccacccccgccgccacagccgcagcagcagcgcatgcaacaccacctgcagcag
atgcaaccggggagcatggggcagatgggccagctcccccaggccttgggagcggaggca
ggggccggcctgcaggcgtatcagcaacgactcctccagcagcagatggggtcccctgct
cagcccaaccccatgagcccccagcagcatatgctcccaagccaggcgcagtccccacac
ctccaaggccagcagatcccttcttctctctccaatcaagtgcgctctccccagcccgtc
ccttctccgcggccgcagtcccagcccccccactccagcccttccccaaggatgcagcct
cagccttcgccacaccacgtctccccgcagaccagttctccacatccgggactggtcgcc
gcccaggccaaccccatggaacaagggcattttgccagcccagaccagagctcgatgctc
tctcagctcgctagcaatccgggcatggcaaacctccacggtgcgggcgccacggacctg
gggctcggccccgataacgcggacttgaattcgaacctctcgcagagtacgctagacata
cactag

DBGET integrated database retrieval system