KEGG   Ailuropoda melanoleuca (giant panda): 100468979Help
Entry
100468979         CDS       T01329                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00010  Glycolysis / Gluconeogenesis
aml00562  Inositol phosphate metabolism
aml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100468979 (MINPP1)
   00562 Inositol phosphate metabolism
    100468979 (MINPP1)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100468979 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100468979 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 SID
Motif
Other DBs
NCBI-GeneID: 100468979
NCBI-ProteinID: XP_002914429
Ensembl: ENSAMEG00000000595
UniProt: D2GZ31
Position
Un
AA seq 487 aa AA seqDB search
MLRGPERLVKVSVAPVAALAVALLSSLSRCSLLEPEDSAVSALSPYFGTKTRYEDANPGL
LADPEAPRRDPELLEDTCTPVQLVALIRHGTRYPTAKQIRKLRQLHGLLQARRPGDWRAG
SAGGRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSLENYGRLQLV
TSSKHRCVDSGAAFLQGLWQHYHPGLPPPDVADMECGPPRINDRLMRFFDHCEKFLTEVE
KNATALYHVEAFKTGPEMQNILKKVAATLQVPVNNLNADLIQVAFFTCSFDLAIKGVKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFRHLDKAIEQKQRSQPI
SSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQLHRKFRSGHIVPYASNLIFVLY
HCKNAKTPKEEFQVQMLLNEKVLPLAHSQETASLYEDLKDHYKDILQSCHTREECELPKV
NNTSDEL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcggacccgagcgcctcgtcaaggtctccgtggcgccggtcgcggccctggct
gtggcgctgctctcgtcgctctcgcgctgctccctcctggagccggaggattccgcggtc
tcggcgctcagcccttacttcggcaccaagacccgctacgaggatgccaaccccgggctg
ctggcggaccccgaggcgccgcggagggaccccgagctgttggaggacacctgcacccca
gtgcagctggtggccctcatccgccacggcacccgctaccctacggccaagcagatccga
aagctgcggcagctgcacggcctgctgcaggcccgcaggcccggcgactggcgcgctggc
tccgccggcggccgcgacctgggcgccgcgctggccgactggcccctgtggtacgcggac
tggatggacgggcagctggtggagaaggggcggcaggacatgcgacagctggcgctgcgc
ctggcctccctcttcccggctctcttcagcctcgagaactacggccgcctgcagctagtc
acaagctccaaacaccgctgcgtggacagcggcgccgccttcctgcaggggctgtggcag
cactaccaccccggcctgccgcctcccgacgtcgcagacatggagtgtggacctccaagg
attaatgatagactaatgaggttctttgatcattgtgagaagtttttaactgaagtggaa
aagaatgctacagctctttatcatgtagaagccttcaaaactggaccagaaatgcagaac
attttaaaaaaggttgcagctactttgcaagtgccagtcaacaatttaaatgcagattta
attcaggtagctttttttacctgttcatttgacctggcaattaaaggtgttaaatctcct
tggtgtgatgtttttgacatagatgatgcaaaggtattagaatatttaaatgatctgaaa
caatattggaaaagaggatatgggtatactattaatagtcggtccagctgcaccctgttt
caggatatcttccggcacttggacaaagcaattgaacagaaacagaggtctcagccaatt
tcctctccagtcatccttcagtttggtcatgcggagacccttcttccactgctctctctc
atgggctacttcaaagataaggaacccctcacagcttacaattacaaggaacaattgcat
cgcaaattccgaagtggccacattgtgccctatgcctcgaacctaatattcgtgctctac
cactgtaaaaatgctaagactcctaaggaggagttccaagtgcagatgctgctgaatgag
aaggtgttaccattggctcactcacaagaaactgcctccttatacgaggatctgaaggac
cactacaaggacatccttcagagctgtcataccagggaagagtgtgaattaccaaaggtg
aacaatacgtctgatgagctatga

DBGET integrated database retrieval system