KEGG   Ailuropoda melanoleuca (giant panda): 100469158
Entry
100469158         CDS       T01329                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase TM7SF2 isoform X2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00100  Steroid biosynthesis
aml01100  Metabolic pathways
Module
aml_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100469158 (TM7SF2)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     100469158 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 100469158
NCBI-ProteinID: XP_002916695
Ensembl: ENSAMEG00000017679
UniProt: D2H4R3
Position
16
AA seq 418 aa
MASPQGSRAPLEFGGPLGAAALMLLLPATMFHLLLVAHSGPARLLGPPPYLPGPEVLWSP
QTLLLWLTWLGLQAALYLLPARKVAEGQELKDKNRLRYPINGFQALVLTALLVGLAVSAG
LPLGALPEMLLPLAFAATLTAFIFSLLLYLKALVAPASALAPGGNSGNPIYDFFLGRELN
PRIWSFDFKYFCELRPGLIGWVLINLALLMQEAELRGSPSLAMWLVNGFQLLYVGDALWH
EEAVLTTMDITHDGFGFMLAFGDLAWVPFTYSLQAQFLLHHPQPLGLPMASVICLINAVG
YYIFRGANSQKNTFRKNPSDPRVAGLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALA
WSLPCGVSHLLPYFYVLYFTALLVHREARDEQQCLRKYGLAWHEYCRRVPYRILPYVY
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcctctcctcagggctcccgggctccgctggaattcgggggacccctgggcgccgcg
gcgctgatgctgctgcttcctgccaccatgttccacctgctcctggtggcccactcgggc
cccgcgcgcctcctgggcccacccccctacctgcccggacccgaagtgctgtggagccct
cagacgctgctgctgtggctcacctggctcggccttcaggcggctctctacctattgccg
gctcgcaaggtggccgagggacaggaattgaaggacaagaatcgcctgcgctaccccatt
aacggcttccaggccctggtgctgacagctctgttggtgggcttggctgtgtcggctggg
ctgcctctgggggcgctcccggaaatgctcctgcccttggccttcgcggccaccctcacc
gccttcatcttcagcctccttctctatctgaaggctctggtggcccctgcctcggccctg
gcacctggggggaactcaggcaatcccatctatgacttcttcctgggacgggagctcaac
ccgcgcatctggtccttcgacttcaaatatttctgtgaactacggcctggcctcatcggc
tgggtcctcatcaacctggccttgctgatgcaggaagcggaacttcgggggagtccctcc
ctggccatgtggctggtcaatggcttccagctactctatgtgggtgatgccctctggcat
gaggaggctgttctcaccaccatggacatcacacacgacggctttggcttcatgctggcc
tttggggacctagcctgggtacccttcacttacagcctgcaggcgcagttcctgctccac
cacccgcagcccctggggctgcccatggcctcagtcatctgcctcatcaatgctgttggt
tactacatcttccgaggagccaattcccagaagaacaccttccggaagaatccttctgac
cccagagtggctggccttgagaccatccccacagccacggggcggcagctgctggtgtct
ggctggtggggtatggtccgccatcccaactaccttggagacctcatcatggctctggcc
tggtccttgccctgtggagtgtctcacctgctgccctatttctacgtcctttacttcacg
gcactgctggtgcaccgcgaggcccgggacgagcagcagtgcctgcgcaagtacggcctg
gcctggcacgagtactgccggcgcgtgccttaccgaatcctgccctacgtctactga

DBGET integrated database retrieval system