KEGG   Ailuropoda melanoleuca (giant panda): 100469289Help
Entry
100469289         CDS       T01329                                 

Gene name
ACOD1
Definition
(RefSeq) aconitate decarboxylase 1
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    100469289 (ACOD1)
Enzymes [BR:aml01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     100469289 (ACOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 100469289
NCBI-ProteinID: XP_002929438
Ensembl: ENSAMEG00000007954
Position
Un
AA seq 470 aa AA seqDB search
MLKSVTESFARVIHGLTVGHLTDHVIQRSKRMILDTLGVGFLGTSTDVFHKASEYSKIYS
SNVSSSVWGRPDLRLPPPYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLMALTEALPS
SQKFSGLDLLLAFNVGIEVQGQLMHFSKEASDIPKRFHPPSVVGTLGSAAAASKFLGLST
AKCQEALAIAVSHAGAPMANAATQTKPLHIGNAARHGMESAFLAMLGLQGNKQVLDMQTG
FGAFYANYSPQVLPNLDSHTWLLDQQDVAFKRFPAHLATHWVADAAVSIRKHLVTDRALL
PTDCIERIVLRVPDVQYVNRPFPDSEHEARHSFQYVACATLLDGGITIPSFHKCQITRPQ
VRELLGKVELEHPWDNLPSFNTLYCEISITLSDGATFTECAETFYGHWRKPLSKEDLRGK
FRANASSMLSCDIVERLIEIVENLEDLEDCSVLTTLLKGPSPPVMASKSI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagtctgtcacagaaagctttgccagagtgatccatggcttgacagtggggcac
ctgacagatcacgttattcaaagaagcaagagaatgatcctggataccctgggcgttggc
ttccttggaaccagtacagacgtgtttcacaaagccagtgaatatagtaagatctacagt
tccaatgtgtccagcagtgtttggggtcgaccagacttaaggctcccgccaccatatgct
gcttttgtgaatggtgtggctattcactcaatggattttgatgacacatggcatcctgct
acccacccttctggagctgtccttcccgtcctcatggctttaacagaagctctcccttca
agtcaaaagttttctggccttgatctgctgctggcattcaatgttgggattgaagtacaa
ggccaattaatgcatttctccaaggaagccagtgacatcccaaagagattccaccccccc
tcagtggtaggaactttgggtagtgcggctgctgcatccaagtttttaggactcagcacg
gcaaagtgccaggaggccctggctattgctgtttctcatgctggggcacccatggcaaat
gctgccactcagaccaagcctcttcatatcggcaacgctgccaggcatgggatggaatcc
gcttttctggcaatgctggggctccaaggaaacaagcaggtcttggacatgcagacaggc
tttggggccttctatgccaactattccccacaagttcttccaaacctagattcccacact
tggctgctggaccagcaggatgtggccttcaagaggttcccggcacacctggccacccac
tgggtggcagacgcagctgtctccatccgaaagcaccttgtcacagacagagccctgctt
cccactgactgcattgagagaattgtgctcagagttccagatgtccagtatgtcaacagg
cccttcccagactcggagcatgaagctcgtcactcattccagtatgtggcctgtgccaca
ctgctcgatggtggcatcaccatcccatcattccacaaatgccagatcaccaggccacag
gtgagggagctgctcggtaaggtggagctggagcacccttgggacaacctgccaagcttc
aacacactctactgtgagataagtatcactctcagcgatggagccaccttcacagagtgc
gcagagaccttctacggccattggaggaagccactgagcaaggaggacctgcgggggaag
ttcagagccaatgcctccagcatgctgtcctgtgacatagtagaaaggcttatagagatc
gtggagaatctagaagacctagaagattgttctgtgctaaccactctgctgaaaggaccc
tctccaccagtgatggcttcaaaatctatctag

DBGET integrated database retrieval system