KEGG   Ailuropoda melanoleuca (giant panda): 100469922Help
Entry
100469922         CDS       T01329                                 

Gene name
BCL2L1
Definition
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01524  Platinum drug resistance
aml04014  Ras signaling pathway
aml04064  NF-kappa B signaling pathway
aml04115  p53 signaling pathway
aml04137  Mitophagy - animal
aml04140  Autophagy - animal
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml04621  NOD-like receptor signaling pathway
aml04630  Jak-STAT signaling pathway
aml05014  Amyotrophic lateral sclerosis (ALS)
aml05145  Toxoplasmosis
aml05166  HTLV-I infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05212  Pancreatic cancer
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100469922 (BCL2L1)
   04630 Jak-STAT signaling pathway
    100469922 (BCL2L1)
   04064 NF-kappa B signaling pathway
    100469922 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    100469922 (BCL2L1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100469922 (BCL2L1)
   04137 Mitophagy - animal
    100469922 (BCL2L1)
  Cell growth and death
   04210 Apoptosis
    100469922 (BCL2L1)
   04215 Apoptosis - multiple species
    100469922 (BCL2L1)
   04115 p53 signaling pathway
    100469922 (BCL2L1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    100469922 (BCL2L1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100469922 (BCL2L1)
   05202 Transcriptional misregulation in cancers
    100469922 (BCL2L1)
   05212 Pancreatic cancer
    100469922 (BCL2L1)
   05225 Hepatocellular carcinoma
    100469922 (BCL2L1)
   05220 Chronic myeloid leukemia
    100469922 (BCL2L1)
   05222 Small cell lung cancer
    100469922 (BCL2L1)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100469922 (BCL2L1)
  Infectious diseases
   05166 HTLV-I infection
    100469922 (BCL2L1)
   05145 Toxoplasmosis
    100469922 (BCL2L1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100469922 (BCL2L1)
   01524 Platinum drug resistance
    100469922 (BCL2L1)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100469922 (BCL2L1)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100469922 (BCL2L1)
Transporters [BR:aml02000]
 Other Transporters
  Pores ion channels [TC:1]
   100469922 (BCL2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 100469922
NCBI-ProteinID: XP_011222034
Ensembl: ENSAMEG00000013710
UniProt: D2H915
Position
Un
AA seq 233 aa AA seqDB search
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg
actgaatcagaggtggagacccccagtgccatcaatggcaacccatcctggcacttggcg
gacagccctgcggtgaatggagccaccggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcagtgaagcaagcgctgagggaggctggggatgagttcgaactgagg
taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcgtat
cagagcttcgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcattgtgcgtggagagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct
tggatccaggagaacggcggctgggacactttcgtggaactctacgggaacaatgcagcg
gctgaaagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg
gctggcgtggttctgctgggctcgctcttcagtcgcaaatga

DBGET integrated database retrieval system