KEGG   Ailuropoda melanoleuca (giant panda): 100469930Help
Entry
100469930         CDS       T01329                                 

Gene name
ZDHHC8
Definition
(RefSeq) zinc finger DHHC-type containing 8
  KO
K20030  palmitoyltransferase ZDHHC5/8 [EC:2.3.1.225]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100469930 (ZDHHC8)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     100469930 (ZDHHC8)
Membrane trafficking [BR:aml04131]
 Protein recycling
  Others
   GRIP associated proteins
    100469930 (ZDHHC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 100469930
NCBI-ProteinID: XP_002920644
Ensembl: ENSAMEG00000011800
Position
Un
AA seq 783 aa AA seqDB search
MPLRQGLRAGNRGPGVLIGVHSVGQDCRPAKYIPVATAAALLVGSSTLFFVFTCPWLTRA
VSPAVPVYNGIIFLFVLANFSMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVR
MKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVG
VVAFGLVYVLNHAEGLGAAHTTITMAVMCVAGLFFIPVIGLTGFHVVLVTRGRTTNEQVT
GKFRGGVNPFTRGCYGNVEHVLCSPLAPRYVVEPPRLPLAARLKPPFLRPELLERAAPLK
VKLSDNGLKAGLGRSKSKGSLDRLDEKPLDLGPPLPPKAEAGTFGGDLQTPRPSSAESAL
SAQRTSPPTPAMYKFRPAFPSGPKAPFCGPGEQVPGPDSLTLGEDSIHSLDFASEPSLDL
PDYTSGGLHAAYPPSPPLSAADTFSGALRSLSLKAASRRGGEHVALQPLRSEGGPPTPHR
SIFAPHALPNRNGSLSYDSLLNPGSPSGHTCPAHPSAGVASYRSPYLHPGAVSDPPRPPP
RSFSPVLGPRPREPSPVRYDNLSRTIMASIQERKDREERERLLRSQADSLFGDSGVYDAP
SSYSLQQASVLSEGPRGPALRYGSRDDLVAGPGFGGARNPALQTSLSSLSSAVSRAPRTS
SSSLQADLANNNAPGPRPGSGSHRSPVRQGPPSPPSTPRSPSYAGPKAVAFIHTDLPESP
PSLAVQRDHPQLKTPPSKLNGQSPGLARLGPATGPPGPSASPARHTLVKKVSGVGGTTYE
ISV
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcgccagggcctgcgggctgggaacagggggcctggcgttctcatcggtgtc
cactcggtgggccaggactgcagacccgccaagtacatcccggtggccacggccgccgcg
ctactggtcggttccagcaccctgttcttcgtgttcacgtgcccatggttgactcgagct
gtgtccccagctgttcctgtctacaatggcatcatcttcctctttgtcctggccaacttc
agcatggccaccttcatggaccctggcgtcttcccccgagcggatgaggacgaggataag
gaggacgacttccgggccccgctgtacaagaatgtggatgtgcggggcatccaggtccgt
atgaagtggtgcgcaacctgccacttctaccgcccacctcgctgctcccactgcagcgtc
tgcgacaactgcgtagaggactttgaccaccactgcccctgggtcaacaactgcattggg
cgtcgcaattaccgatacttcttcctgttcctgctgtcactcagcgcacacatggtgggt
gtcgtcgcctttggcctggtctatgtgctgaaccacgctgaggggctgggagctgcccac
accaccatcaccatggccgtcatgtgtgtggctggcctcttcttcatccctgtcatcggc
ctcactggcttccacgtggtgctggtcactcgggggcgtaccaccaatgaacaggtgacg
gggaagttccgtgggggcgtgaaccccttcacccgaggctgctatgggaatgtggagcac
gtgctgtgcagccctctggcaccccggtacgtggtggagcctccccggctgccgctggct
gctcgcctgaagccacccttccttcggcccgagctcctggagcgagctgccccactcaag
gtcaagcttagtgacaacgggctgaaggctggcctgggccgcagcaagtccaagggcagt
ctggaccggctggatgagaagccgctggacctggggccgccactgccccccaaggcggag
gccggcacgttcggaggtgacctgcagaccccacgcccgagcagtgctgagagcgccctg
tcggcgcagaggaccagtcccccgacacctgccatgtacaagttccggcctgcctttccc
tcgggtcccaaggcgcccttctgtgggcctggtgagcaggtccctggccctgactccctg
acactgggggaggacagcatccacagcctggactttgcatcagagcccagcttggacctc
cctgactacacatccggaggcttgcatgcagcctacccgccgtccccgccactcagcgct
gctgacaccttttcgggggccttgcgctccctgagcctcaaggcagcaagccggaggggt
ggggagcacgtggccctgcagcctctgcgctctgagggcgggccccccacgccccaccgc
agcatctttgcccctcacgcgctgcccaaccgcaatggcagcctgtcctatgacagtctg
cttaaccccggctctcccagtggccacacgtgcccagcccacccctctgccggcgtggcc
agctaccgctcgccgtacctgcacccgggggcggtgagtgacccgccacggcccccgccc
cgtagcttcagcccggtgctgggcccccggccgcgggagccctcacctgtgcgctacgac
aacctgtccaggaccatcatggcctccatccaggagcgcaaggacagagaggagcgggaa
cggctgctgcgctctcaggccgactcgcttttcggtgactcgggcgtctatgatgcgccc
agctcctacagcctgcagcaggccagcgtgctgtccgagggcccccgcgggcctgctctg
cgctacggctccagggatgacctggtggcggggcccggcttcggtggcgcccgcaacccc
gcgctgcagacctcactgtcctcgctgtccagcgccgtgagccgggcaccgcggacctcc
tcctcctccctgcaggccgacctggccaacaacaatgcccctgggcctcggcccggcagc
ggctcgcacaggtccccagtgcgccagggtcccccctccccacccagcacgccccgctca
ccctcctatgcaggccccaaagctgtcgccttcatccacacggacctcccggagtcgcca
ccctcgctggccgtgcagagggaccaccctcagctgaagacccccccaagtaagcttaac
gggcagtccccgggcctggcccgcctggggcctgccactggccccccagggccctccgcc
agccctgcccggcacacgctcgttaagaaggtgtccggcgtgggtgggaccacgtacgag
atctcagtgtga

DBGET integrated database retrieval system