KEGG   Ailuropoda melanoleuca (giant panda): 100470220Help
Entry
100470220         CDS       T01329                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00500  Starch and sucrose metabolism
aml01100  Metabolic pathways
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04910  Insulin signaling pathway
aml04922  Glucagon signaling pathway
aml04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100470220 (GYS2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100470220 (GYS2)
   04152 AMPK signaling pathway
    100470220 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100470220 (GYS2)
   04922 Glucagon signaling pathway
    100470220 (GYS2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100470220 (GYS2)
Enzymes [BR:aml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100470220 (GYS2)
Glycosyltransferases [BR:aml01003]
 Polysaccharide
  Storage polysaccharide
   100470220 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 GAPES3
Motif
Other DBs
NCBI-GeneID: 100470220
NCBI-ProteinID: XP_002929034
Ensembl: ENSAMEG00000016198
UniProt: D2I1F2
Position
Un
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLSGLPQWEVEELPIEDVLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
DNYFLIGPYFEHNMKTQVEQCEPVNDTVRRAMDSMNKHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDNADGKHVIAQFH
EWQAGTGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLEALSRLNFLLRVHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDIAHSVKEKFGKKLYDALLRGEIPDMDNIL
DRDDVTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNSRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARYLTLSRAFPDKFHMEPTSPPTTEGFKYPRPSSVPPSPSGSQVSSPQSSDVE
DEEDDERYNEEEEAERDRLNIKSPFSLGRVPRGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggccgatctctatcagtgacatccctgagcgggcttcctcagtgggaagtt
gaagaacttcccatagaggatgtactgctctttgaagtcgcgtgggaagtaaccaataaa
gttggtggcatctatactgtgattcagacgaaggccaaaaccacagcagatgaatgggga
gacaattattttctgattggcccatattttgagcataatatgaagactcaggtggaacag
tgtgaacctgtaaatgatactgttagaagagcaatggactcaatgaataaacatggctgc
caggtgcactttggaagatggctgatagaggggagtccttatgtggtgctcttcgacata
ggctattcggcttggaacctggaccggtggaagggtgacctctgggaagcgtgcagtgtc
ggcataccttatcatgaccgagaagccaacgatatgctgatattcggatctttaactgcc
tggttcctaaaagaggtgacagataatgcggatgggaagcatgtcattgcccaattccat
gaatggcaggcgggaactggactgatcctttctcgagctcggaaacttcccatcgctacc
atatttaccactcatgccacactgcttgggaggtatctctgtgcagcaaacatcgatttc
tacaaccatctcgataagtttaacatagacaaagaggctggggaaaggcagatttaccac
cggtactgcatggagagggcctctgtccattgtgctcatgtgttcaccacagtatctgaa
ataacagcaatagaagcagagcatatgctgaagaggaagcctgatgtagttactccaaat
ggcttgaacgttaagaaattttcagcagtgcatgagtttcaaaatttacatgccatgtac
aaggccaggatccaagattttgttcgaggtcatttctatggtcatctggactttgatctt
gaaaagactttgttccttttcattgctgggagatatgagttttcaaacaaaggagctgac
atcttcctagaagccttatccaggctaaattttctgctgagggtgcataaaagtgacgtc
acagtggtggtgtttttcatcatgcctgccaagacaaataatttcaatgtggaaacgctg
aaaggccaggcagtgcggaaacagctatgggacattgcacattctgtgaaggaaaaattt
gggaagaaactctatgatgctttgttaagaggagaaattcctgacatggacaatattttg
gatcgagatgatgtaacaattatgaaaagagccatcttctcaactcagcgacagtctttg
cctcctgtgaccactcacaacatgattgatgactccactgatcccatcctcagcaccatt
agacggatcggacttttcaacagccgcacagacagagtcaaggtgattttgcacccagag
tttctatcctccaccagccccttattacccatggattatgaagagtttgtccgaggttgt
catcttggagtatttccatcatactatgaaccgtggggttatactccggctgaatgcact
gtgatgggtatccccagtgtgacgaccaacctttccggctttggctgtttcatgcaggag
cacgtggctgatcctactgcttacggtatttacattgttgacaggcggttccgttctcca
gatgattcctgcaatcagctgactcagtttctctatggattttgcaaacagtcacgccgc
caaagaattattcagagaaaccgaactgagaggctctccgatcttctggattggagatac
ttgggcagatattatcaacacgccaggtacctgacgttaagcagagcttttccagataaa
ttccatatggagcctacatcaccacccacgacggaaggatttaaataccccaggccttcc
tcagttccaccttccccttcagggtctcaggtctctagtcctcaaagcagtgatgtggaa
gatgaagaagacgatgagcggtacaatgaggaagaggaggctgaaagggatcggttaaat
atcaagtcgccattttctctgggccgtgttcctcgtgggaagaaaaagctgcatggtgaa
tacaagaactga

DBGET integrated database retrieval system