KEGG   Ailuropoda melanoleuca (giant panda): 100470240Help
Entry
100470240         CDS       T01329                                 

Gene name
PLA2G4D
Definition
(RefSeq) phospholipase A2 group IVD
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00564  Glycerophospholipid metabolism
aml00565  Ether lipid metabolism
aml00590  Arachidonic acid metabolism
aml00591  Linoleic acid metabolism
aml00592  alpha-Linolenic acid metabolism
aml01100  Metabolic pathways
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04072  Phospholipase D signaling pathway
aml04217  Necroptosis
aml04270  Vascular smooth muscle contraction
aml04370  VEGF signaling pathway
aml04611  Platelet activation
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04724  Glutamatergic synapse
aml04726  Serotonergic synapse
aml04730  Long-term depression
aml04750  Inflammatory mediator regulation of TRP channels
aml04912  GnRH signaling pathway
aml04913  Ovarian steroidogenesis
aml04921  Oxytocin signaling pathway
aml05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100470240 (PLA2G4D)
   00565 Ether lipid metabolism
    100470240 (PLA2G4D)
   00590 Arachidonic acid metabolism
    100470240 (PLA2G4D)
   00591 Linoleic acid metabolism
    100470240 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    100470240 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100470240 (PLA2G4D)
   04010 MAPK signaling pathway
    100470240 (PLA2G4D)
   04370 VEGF signaling pathway
    100470240 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    100470240 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100470240 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100470240 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    100470240 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    100470240 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100470240 (PLA2G4D)
   04913 Ovarian steroidogenesis
    100470240 (PLA2G4D)
   04921 Oxytocin signaling pathway
    100470240 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100470240 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    100470240 (PLA2G4D)
   04726 Serotonergic synapse
    100470240 (PLA2G4D)
   04730 Long-term depression
    100470240 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100470240 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100470240 (PLA2G4D)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100470240 (PLA2G4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 100470240
NCBI-ProteinID: XP_002913295
Ensembl: ENSAMEG00000016313
Position
Un
AA seq 817 aa AA seqDB search
MERLTTTGPPGRPHQGEASACWRLTVRVLEARNLGWTDLLSEADPYVTLQLSTVPGTKFK
TKTIMNSSHPVWNETFSFLIQSQVKNVLELNVYDEDSVTEDDACFKFLYDVSEVLPGELL
RKTFSLQPQGQEELDVEFLLEKTSDCPENLITNNVLVARELSCLDVHLDHMESTATITDQ
AWLELELVLTGSYENTQTSALGPASAFRFHYMAAQDAELSARLRSSESNGWNSDKTAGHL
TVPLRSLAMGKEVTINIPATNTPGVRLQIKAESCPKELAVRLGFDLCAEEQAFLSRRKQV
VAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGI
SGSTWTMAHLYGDPEWSQKDLEGPIKYAREHLTKSKMEAFSPEHLASYHQELELRAEQGH
PTTFVDLWALVLESMLHGQVMDQKLSEQRAALEQGQNPLPLYLSLNVKENNLETLDFKEW
VEFSPYEVGFLKYGAFVPTELFGSEFFMGRLMRRLPESRICFLEGIWSNIFSLNLLDVWY
GLISSDDTRKQHIKDKIRSLEESPASLKTSSWLEASWLQPGTALARAFKGLLTDRPLHQH
SCNFLRGLQLHQDYCSQKDFSTWADCQPDSTASQLTPQEPQLCLVDAGYFLNTSCPSMFR
SGRRLDLILAFDYSLPSPFEALKQTEVYCRARGLPFPRVEPSPQDQRQPTECHLFSDPSC
SDAPVLLHFPLVNASFRDHSAPGVRRSPAELPAGQVDLTGATSPYSLFNMTYKEEDFDRL
LQLSDYNVRNSQGAILQALRTAVKHRALGARPPAALI
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggaaagactgacaactacgggaccacctggccgccctcaccagggggaggcctctgct
tgctggcggctcactgtgagggttctggaggcacggaacctgggctggactgacctgttg
agtgaggcagacccctatgtgaccctacagctgtccaccgtccctggaacaaagtttaag
accaaaacaatcatgaactccagtcatcctgtgtggaatgagaccttcagtttcctaatc
cagagtcaggtcaagaatgtcctggagctaaacgtctatgatgaggactcagtcacggaa
gatgatgcctgcttcaagtttctctatgacgtctcagaagtcctccctggcgagctgctc
cggaagaccttctccctgcaaccccagggacaggaggagctggacgtggagttcctgctg
gaaaaaacgtcagactgtccagaaaacctcatcaccaacaacgtccttgtggcccgagag
ctgtcatgcctggatgtccatctggaccacatggagagcacagccaccatcacagatcag
gcctggctggagctggagctcgtgctgacggggtcctatgaaaacacacagacatctgcg
ctgggtccagcctctgccttccgcttccattacatggcagcccaagacgcagagctgagt
gcacgtctgaggagctctgaaagcaatggctggaattccgacaagacagctgggcacctc
actgtgcccctgaggtcactggccatgggaaaggaggtgacgattaacattcctgctaca
aataccccaggagtgaggctgcagatcaaggctgagagctgccctaaggagctggctgtg
cgcctgggctttgatctgtgcgcagaggagcaggccttcctgagcaggaggaaacaggtg
gtcgccaaggctctcaagcaggccctgcagctggacagagacctacaggaggatgaggtc
cccgtggtgggcatcatggccacaggaggaggtgcccgggccatgacctctctctacggc
cacctgttggccctgcagaagctgggcctcctggactgtgtgacctacttcagcggcatc
tcaggctctacatggacaatggcccacctctacggggaccctgagtggtcacagaaggac
ctcgaaggacccatcaaatatgccagggaacacctgaccaagagcaagatggaggccttc
tccccagagcacctagcgagctaccatcaggagctggaactgcgggcggagcagggccac
cccacgacttttgtggacctgtgggctctcgtgctggagtccatgctgcacggccaggtg
atggatcagaagctgtcggaacagagagcagcactggaacagggccagaaccctctgccc
ctctacttgagcctcaatgtcaaagagaacaatctggagaccctcgacttcaaggagtgg
gtggagttttccccctatgaggtcgggttcctgaagtatggagccttcgtccctaccgag
ctcttcggctccgagttcttcatggggaggctgatgaggaggctccctgagtcccggatc
tgctttctggaaggtatctggagcaacattttctccctgaacttgctggatgtctggtat
ggcctcatcagctctgatgacacccggaagcagcacatcaaggacaagatcaggagcctg
gaggagtctcctgcctccttgaagacctcctcatggttggaggcctcatggctgcaaccc
gggacagcactggccagggcgtttaagggcttgctgacggacaggccgctccaccagcac
agctgcaacttcctccggggcctccagctgcaccaggactactgtagccagaaagacttc
tccacctgggcagactgccagccagactccactgctagccagctgactcctcaggagccc
cagctctgcctggtagatgccggctatttcctcaacaccagctgtccctccatgttccgg
tcaggccgcaggctggacctcatacttgccttcgactactccctaccctcgccctttgag
gcactgaagcagactgaggtgtactgccgggcccgaggactgccattccctcgagtggag
cccagccctcaggaccaacgccagccaacagagtgccacctcttctcagacccctcctgc
tccgatgccccagtcctgctgcacttcccactggtcaacgcctccttcagggaccactca
gcccctggtgtccggcgcagccctgcagagctcccagctggccaggtggatctcactggg
gccacctccccctactccctgttcaacatgacctacaaggaggaagactttgatcgtctg
ctgcagcttagtgactataacgtacggaacagccagggcgccattctgcaggccttgagg
actgccgtgaagcaccgggccctgggggccaggcctccagcagcactgatttga

DBGET integrated database retrieval system