KEGG   Ailuropoda melanoleuca (giant panda): 100470910Help
Entry
100470910         CDS       T01329                                 

Gene name
USP51
Definition
(RefSeq) ubiquitin specific peptidase 51
  KO
K11366  ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100470910 (USP51)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100470910 (USP51)
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100470910 (USP51)
Ubiquitin system [BR:aml04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100470910 (USP51)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     100470910 (USP51)
    SLIK complex
     100470910 (USP51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 zf-UBP Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 100470910
NCBI-ProteinID: XP_002931245
Ensembl: ENSAMEG00000019294
UniProt: D2I7W5
Position
Un
AA seq 703 aa AA seqDB search
MAQVRETSLPSGSLVRWSSGSGGGASPEEAAEKAGEMEKEAVGAAKACSGLGAEEMKLDP
LQEHKPAPENLTWSDGGGDNKVLPSTPPRCYSSSSPLCPRRKPRPRPQPRARSRGPPGLS
APPLPPSHPSPPPLTGPQPWRRPRRRSRPASRPQMLHSCSSELGGSGDRGGLGDWLLEVE
FDQGPTGCTHVESFKVAKNWRKNLRLIYQRFVWSGTPETRKHKAKSCICHVCSTHMNRLH
SCLACVFFGCFTEKHIHKHAETKQHNLAVDLYRGVIYCFMCKDYVYDKDMERIAKETKEK
NLKLTSTSTDVSQQQCMTSGVEERHSTCESKEQEPKLVKPKKKRRKKSVYTIGLRGLINL
GNTCFMNCIVQALTHIPLLKDFFLSDKHKCIMTSPSLCLVCEMSSLFNAMYSGSRTPHIP
YKLLHLIWIHAEHLAGYRQQDAHEFLIAILDVLHRHSKDDSIGQEANNPNCCNCIIDQIF
TGGLQSDVTCQACHSVSTTIDPCWDISLDLPGSCATFSSQSPERADSTVSRDDHIPGIPS
LTDCLQWFTRPEYLGSNSKIKCSSCQSYQESIKQLTMKKLPVVACFHLKRFEHVGKQRRK
INTFISFPLELDMTPFLASTKESRMKEGQPQTDCTSNENKYSLFAVINHHGTLESGHYTS
FIRQQKDQWFSCDDAIITKATIEDLLYSEGYLLFYHKQGLEKD
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagttcgggaaacttccttgccctccggctctttggtccgctggagctcggga
agtgggggaggagcctctcccgaggaggcggctgaaaaggcgggggaaatggagaaggag
gcggtgggggcggcaaaggcgtgttcaggcctgggagctgaggagatgaagctggaccca
ttacaagagcataagcctgctcctgagaacttgacgtggagtgacggcggcggcgataat
aaggtgctcccttcaacccctcctcgctgttacagcagctcctcgcccctttgcccgcgc
cgcaagccccgccctcggccccagccccgggcccgctcgcgagggccgcctggtctctcc
gccccacccctgcctccatcccatccttcccctccgcctctgaccggaccccagccctgg
cgcagaccgcggcgtagatccaggccggcgtctaggccccagatgctgcacagctgttct
agtgaattaggtggctctggggatcgaggtggtttaggggactggttgctggaggtggag
tttgatcagggtcctacaggctgcacgcacgtggagagctttaaagtggctaagaactgg
cggaagaacctgaggttgatttaccagcgtttcgtatggagtgggaccccagaaactagg
aaacataaggcaaagtcgtgcatctgccatgtatgtagtacccatatgaacagactccac
tcttgtctcgcctgtgtcttttttggctgctttactgagaaacatattcataaacatgca
gaaacaaaacagcacaatttagccgtagacctctatcgtggggttatatattgctttatg
tgtaaggattatgtatatgacaaagacatggaacgaattgccaaagaaacaaaagagaaa
aatttgaaattaacttccacctcaacagatgtttctcaacaacagtgtatgacatcaggt
gttgaagagaggcattcaacctgtgagtcaaaggaacaagagccaaaattggtgaaaccc
aagaaaaagaggagaaaaaagtcagtctataccataggcctgagagggctaatcaatctt
gggaacacatgctttatgaattgtattgtccaggcacttacccatattcctctattgaaa
gatttctttctctctgacaagcataaatgtataatgacaagccccagcttgtgtcttgtc
tgtgaaatgtcttctctttttaatgctatgtactctgggagccgaactcctcacattccc
tataagttattgcatctaatatggattcatgcagaacacttagcagggtacaggcagcag
gatgcccatgagttcctcattgcaatattagatgtgctgcatagacacagcaaagacgat
agcattgggcaggaggccaataaccccaactgctgtaactgcatcatagaccaaatcttt
acaggtggcttgcaatcagatgtcacatgtcaagcttgtcatagtgtctctaccacaata
gacccatgctgggacatcagtttggacttgcctggctcttgtgccacattcagttcccag
agtccagagagagctgatagcacagtgagtagggatgaccacataccaggaatcccctca
ctcacagactgcctacagtggtttacaaggccagagtacctaggaagcaattccaaaatc
aaatgcagtagttgccaaagctatcaggaatctatcaaacaactcacaatgaagaaatta
cctgttgtggcctgttttcatctcaagcgatttgagcatgtaggtaaacagaggcggaag
attaatacttttatctcctttcccttggagctggacatgactccatttttggcctccact
aaggagagcagaatgaaagaaggccagccacaaacagattgtacatccaacgagaataaa
tattccttgtttgcagtgattaatcaccatggaactttggaaagtggacactacaccagc
tttatccggcaacaaaaggaccaatggtttagctgtgatgatgccatcatcaccaaggct
accattgaggacttactctacagtgaagggtatttactgttttatcacaaacagggtcta
gagaaagattag

DBGET integrated database retrieval system