KEGG   Ailuropoda melanoleuca (giant panda): 100471254
Entry
100471254         CDS       T01329                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100471254 (AKAP5)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     100471254 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 100471254
NCBI-ProteinID: XP_019649492
Ensembl: ENSAMEG00000019586
UniProt: D2GYI6
Position
14
AA seq 423 aa
METTVSEIQVESKDEKRPTEVSPQDERQEERASVLCFKRRKKATKAMKPKASSEAAGTAR
KCPPEAGASDQPQPPGGAWASIKRLVTRRKRSESSKQQKPFEAKVQPEISAEDADVSKKK
AKSGLKIPCIKFSKGEKRSNHSKIIEDSDCSIRVQGEAAHLDTKDDQAAKTQLPQDVSKD
VSQKGGDEVCEPDVSNSTTTAGEKVISVELGLDTGHSAIHPATLILERDTETIEEKQSVQ
GQQASPLETSETAPQPPVVSEVPPPPASPDQQIVEDARSNILESGPNGEEHESREMVAEE
SEPKDTELSQESELRENEVTAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNVPKQFL
ISIENEQVGVFANDSGFEGRTSEQYETLLTETASSLVKNAIQLSIEQLVNEMASDDNKMN
NLL
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggaaaccacggtttccgaaattcaagtcgaaagcaaggatgagaagagacccacagaa
gttagtcctcaagatgagagacaggaggaaagagcatcagtgctttgcttcaagcgaaga
aagaaagcaactaaagcaatgaagcccaaagctagctctgaagctgctggtacagcaaga
aagtgtcccccagaagcaggagcttcggatcagccacagcccccagggggggcctgggcc
tcaatcaaacgtctggtgacacgcaggaaaaggtcagaatcttcaaagcagcagaagccc
tttgaggctaaagtgcagcctgaaatcagcgctgaggatgctgatgtttctaagaaaaag
gcaaaatccggacttaagattccctgcataaaattctcaaaaggagagaaaagaagtaat
cattccaaaatcatagaagactcagactgcagcatcagagtccagggagaggctgcacat
ttggatacaaaagatgaccaggcagcaaagacccagttgccccaggatgtaagtaaagat
gtctcacagaaagggggtgatgaggtctgtgaaccagatgtgagcaacagcacaactaca
gctggagagaaagtgatttcagtagaacttgggttagatacggggcattctgccattcac
ccggcaacactaatccttgaaagagatactgaaacgattgaggaaaaacaaagtgtccaa
ggccagcaagcaagcccacttgaaacttcagaaacagcacctcagccaccagtggtttct
gaggttcctcccccacctgcaagcccagatcagcaaattgtagaagacgccagaagcaat
atcctcgaaagtggaccaaatggggaagagcacgaaagtagagagatggtagctgaagag
agtgagccgaaagatactgaattgagccaggaatcagagctgagagaaaatgaggtcact
gcagagaaacccaaaccagaagaaagcaaaagaatggagccaattgctattattattaca
gacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccctaagcaattctta
atttcaattgaaaatgagcaagtaggggtttttgctaatgatagtggttttgagggtaga
acttcagaacaatacgaaacactcttaacagaaacagcttcttctcttgtcaagaatgct
atccaattgtctatagaacagctggttaatgaaatggcctctgatgataataaaatgaac
aatcttctatag

DBGET integrated database retrieval system