KEGG   Ailuropoda melanoleuca (giant panda): 100471563
Entry
100471563         CDS       T01329                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01523  Antifolate resistance
aml04010  MAPK signaling pathway
aml04060  Cytokine-cytokine receptor interaction
aml04061  Viral protein interaction with cytokine and cytokine receptor
aml04064  NF-kappa B signaling pathway
aml04071  Sphingolipid signaling pathway
aml04150  mTOR signaling pathway
aml04210  Apoptosis
aml04217  Necroptosis
aml04350  TGF-beta signaling pathway
aml04380  Osteoclast differentiation
aml04612  Antigen processing and presentation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04640  Hematopoietic cell lineage
aml04650  Natural killer cell mediated cytotoxicity
aml04657  IL-17 signaling pathway
aml04660  T cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04668  TNF signaling pathway
aml04920  Adipocytokine signaling pathway
aml04930  Type II diabetes mellitus
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04940  Type I diabetes mellitus
aml05010  Alzheimer disease
aml05014  Amyotrophic lateral sclerosis
aml05132  Salmonella infection
aml05133  Pertussis
aml05134  Legionellosis
aml05135  Yersinia infection
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05143  African trypanosomiasis
aml05144  Malaria
aml05145  Toxoplasmosis
aml05146  Amoebiasis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05205  Proteoglycans in cancer
aml05310  Asthma
aml05321  Inflammatory bowel disease
aml05322  Systemic lupus erythematosus
aml05323  Rheumatoid arthritis
aml05330  Allograft rejection
aml05332  Graft-versus-host disease
aml05410  Hypertrophic cardiomyopathy
aml05414  Dilated cardiomyopathy
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100471563 (TNF)
   04350 TGF-beta signaling pathway
    100471563 (TNF)
   04064 NF-kappa B signaling pathway
    100471563 (TNF)
   04668 TNF signaling pathway
    100471563 (TNF)
   04071 Sphingolipid signaling pathway
    100471563 (TNF)
   04150 mTOR signaling pathway
    100471563 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100471563 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100471563 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100471563 (TNF)
   04217 Necroptosis
    100471563 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100471563 (TNF)
   04620 Toll-like receptor signaling pathway
    100471563 (TNF)
   04621 NOD-like receptor signaling pathway
    100471563 (TNF)
   04622 RIG-I-like receptor signaling pathway
    100471563 (TNF)
   04625 C-type lectin receptor signaling pathway
    100471563 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    100471563 (TNF)
   04612 Antigen processing and presentation
    100471563 (TNF)
   04660 T cell receptor signaling pathway
    100471563 (TNF)
   04657 IL-17 signaling pathway
    100471563 (TNF)
   04664 Fc epsilon RI signaling pathway
    100471563 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100471563 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100471563 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100471563 (TNF)
  09163 Immune disease
   05310 Asthma
    100471563 (TNF)
   05322 Systemic lupus erythematosus
    100471563 (TNF)
   05323 Rheumatoid arthritis
    100471563 (TNF)
   05321 Inflammatory bowel disease
    100471563 (TNF)
   05330 Allograft rejection
    100471563 (TNF)
   05332 Graft-versus-host disease
    100471563 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100471563 (TNF)
   05014 Amyotrophic lateral sclerosis
    100471563 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100471563 (TNF)
   05410 Hypertrophic cardiomyopathy
    100471563 (TNF)
   05414 Dilated cardiomyopathy
    100471563 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100471563 (TNF)
   04940 Type I diabetes mellitus
    100471563 (TNF)
   04932 Non-alcoholic fatty liver disease
    100471563 (TNF)
   04931 Insulin resistance
    100471563 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100471563 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100471563 (TNF)
   05135 Yersinia infection
    100471563 (TNF)
   05133 Pertussis
    100471563 (TNF)
   05134 Legionellosis
    100471563 (TNF)
   05152 Tuberculosis
    100471563 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100471563 (TNF)
   05170 Human immunodeficiency virus 1 infection
    100471563 (TNF)
   05164 Influenza A
    100471563 (TNF)
   05161 Hepatitis B
    100471563 (TNF)
   05160 Hepatitis C
    100471563 (TNF)
   05168 Herpes simplex virus 1 infection
    100471563 (TNF)
   05163 Human cytomegalovirus infection
    100471563 (TNF)
   05169 Epstein-Barr virus infection
    100471563 (TNF)
   05165 Human papillomavirus infection
    100471563 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100471563 (TNF)
   05144 Malaria
    100471563 (TNF)
   05145 Toxoplasmosis
    100471563 (TNF)
   05140 Leishmaniasis
    100471563 (TNF)
   05142 Chagas disease
    100471563 (TNF)
   05143 African trypanosomiasis
    100471563 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100471563 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100471563 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100471563 (TNF)
Cytokines and growth factors [BR:aml04052]
 Cytokines
  Tumor necrosis fators
   100471563 (TNF)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Haparin
  Cytokines
   100471563 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100471563
NCBI-ProteinID: XP_002930078
Ensembl: ENSAMEG00000009478
UniProt: D2I4B3
Position
5
AA seq 233 aa
MSTESMIRDVELAEESLPKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR
EELPDGLQLINPLAQTVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELT
DNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRE
TAEGTEAKPWYEPIYLGGVFQLERGDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctggccgaggagtcactccccaagaag
gcagggggcccccagggctccagaaggtgcttgtgcctcagcctcttctccttcctcctc
gtcgcaggagccaccacgctcttctgcctgctgcacttcggcgtgatcggcccccagagg
gaagagctcccagatggactccaactaatcaaccctctggcccagacagtcaaatcatct
tctcgaactccgagtgacaagcctgtagctcatgttgtagcaaaccccgaagctgagggg
caactccagtggctgagccggcgtgccaatgccctcctggccaatggtgtggagctgaca
gacaaccagctaatagtgccatcagacgggctgtacctcatctactcccaggtcctcttc
aagggccagggatgcccttccacccatgtgctcctcacccacaccatcagccgcttcgct
gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccaaagggag
accgcagaggggactgaggccaagccctggtacgagcccatctacctgggaggggtcttc
caactggagaggggtgatcgactcagcgctgagatcaacctgcctgactacctcgacttt
gccgagtctgggcaggtctactttggaatcattgccctgtga

DBGET integrated database retrieval system