KEGG   Ailuropoda melanoleuca (giant panda): 100471940
Entry
100471940         CDS       T01329                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00230  Purine metabolism
aml01100  Metabolic pathways
aml01522  Endocrine resistance
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04072  Phospholipase D signaling pathway
aml04114  Oocyte meiosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04371  Apelin signaling pathway
aml04540  Gap junction
aml04611  Platelet activation
aml04713  Circadian entrainment
aml04714  Thermogenesis
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04727  GABAergic synapse
aml04742  Taste transduction
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04913  Ovarian steroidogenesis
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04921  Oxytocin signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04972  Pancreatic secretion
aml04976  Bile secretion
aml05032  Morphine addiction
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100471940 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100471940 (ADCY4)
   04371 Apelin signaling pathway
    100471940 (ADCY4)
   04020 Calcium signaling pathway
    100471940 (ADCY4)
   04072 Phospholipase D signaling pathway
    100471940 (ADCY4)
   04024 cAMP signaling pathway
    100471940 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100471940 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100471940 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100471940 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100471940 (ADCY4)
   04062 Chemokine signaling pathway
    100471940 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100471940 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100471940 (ADCY4)
   04912 GnRH signaling pathway
    100471940 (ADCY4)
   04913 Ovarian steroidogenesis
    100471940 (ADCY4)
   04915 Estrogen signaling pathway
    100471940 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100471940 (ADCY4)
   04921 Oxytocin signaling pathway
    100471940 (ADCY4)
   04926 Relaxin signaling pathway
    100471940 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    100471940 (ADCY4)
   04918 Thyroid hormone synthesis
    100471940 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100471940 (ADCY4)
   04916 Melanogenesis
    100471940 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100471940 (ADCY4)
   04927 Cortisol synthesis and secretion
    100471940 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100471940 (ADCY4)
   04270 Vascular smooth muscle contraction
    100471940 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100471940 (ADCY4)
   04971 Gastric acid secretion
    100471940 (ADCY4)
   04972 Pancreatic secretion
    100471940 (ADCY4)
   04976 Bile secretion
    100471940 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100471940 (ADCY4)
   04727 GABAergic synapse
    100471940 (ADCY4)
   04725 Cholinergic synapse
    100471940 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100471940 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100471940 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100471940 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100471940 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100471940 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100471940 (ADCY4)
   04714 Thermogenesis
    100471940 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100471940 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100471940 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100471940 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100471940 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100471940 (ADCY4)
   05163 Human cytomegalovirus infection
    100471940 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100471940 (ADCY4)
Enzymes [BR:aml01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100471940 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 100471940
NCBI-ProteinID: XP_034504588
Ensembl: ENSAMEG00000015964
Position
20
AA seq 1170 aa
MEQSSHNQLGKGWEATGSAWQMGSPRGWGNGVEVAWTQGERHGWGTERPHAVTRHLALPS
PGGPPSTPAPQRGAGGTMARLFSPRPPPSEDLFYETYYSLSQQYPLVLLLLVIVLCALLA
MLAVASASGRDLASDRGFLTTVLCALGGFSLLLGLASREQRLQRWTRPLSVLVWAALLGL
GHGFLFTGGLVSAWDQVSFFLFVIFTVYAMLPLGMRDAAAAGLASSLSHLLALGLYLGPQ
PDSRPALLPQLAANAVLFLCGNVAGAYHKALMERALRATFREALRSLHSRRRLDTEKKHQ
EHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFT
RLASECSPKELVLMLNELFGKFDQIAKVPPPPPAHTHTPRSMNACGSRSWETVTTVSLGY
RSPCQTTPSTACAWGWTCAGPSGQLRKLRAATGVDINMRVGVHSGSVLCGVIGLQKWQYD
VWSHDVTLANHMEAGGVPGRVHITGATLALLAGVYAVEDASMEHRDPYLRELGEPTYLVI
DPRAEEEEEKGTAGGLLSSLEGPQMRPSLLMTRYLESWGAAKPFAHLSHLESPVSTSTPL
PEKALASFSPQWSLDRSRTPRGLDEDLDTGDAKFFQVIEQLNSQKQWKQSKDFNPLTLYF
REKELEKEYRLSALPAFKYYAACTFLVFFSNFIIQMLVTNRPPALAVTYSITFLLFLLLL
FVCFSEHLTKCVLKGPKMLHWLPALSGLVATRPGLRVALGTATILLVFVMAITSLFFLPA
ATNCPSGASNVSSVASNLSWELPGSLPLISVPYSMHCCVLGFLSCSLFLHMSFELKLLLL
LLWLGVSCSLFLHSHAWLSDCLIARLYPDPLDSRPGVLKEPKVMGAISFFIFFFTLLVLA
RQNEYYCRLDFLWKKKLRQEQEETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQ
SYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTI
GSTYMAATGLNATPGQDAQQDAERSCNHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGL
NHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETARVLQSLGYTCYSRG
IIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3513 nt   +upstreamnt  +downstreamnt
atggagcagtcttctcacaaccaactgggaaaaggctgggaggccacagggagtgcctgg
cagatgggatcgccgcgaggctgggggaacggggtggaagtggcttggacccagggagag
aggcacggctggggcacagagcggcctcacgcggtaacgcggcacctggccctccccagc
cccgggggtccaccctccacgccggcgccgcagcgaggggcaggggggaccatggcccgc
ctcttcagtccccggccgccccccagcgaagacctcttctacgagacctactacagcctg
agtcagcagtacccactggtgcttctgctgctggtgatcgtgctctgcgcgctcctggcg
atgctggctgtcgcctccgccagcggcagggatctagcttcagaccggggcttcctgacc
accgtgctgtgcgcgctcgggggcttctcgctgctcctgggcctggcttcccgcgagcaa
cggctgcagcgctggacacgtcccctgtcggtcctcgtgtgggccgcgctactcgggcta
ggccatggcttcctgttcaccgggggcctggtgagcgcctgggaccaggtgtcctttttc
ctcttcgtcatcttcaccgtgtacgccatgttgcccttgggcatgcgggatgccgccgct
gcgggccttgcctcgtcgctctcccacctgctggcccttgggctgtaccttgggcctcag
ccggactccaggccggcgctgctgccgcagctggcagcgaacgccgtgttgttcttgtgc
gggaacgtggccggagcgtaccacaaggcgctgatggagcgcgctctgcgcgccacgttc
cgggaggctcttcgttccctgcactcgcgccggcggctggacaccgagaagaagcaccag
gaacaccttctcttgtccattcttcctgcctacctggcccgagagatgaaggcagagatc
atggcacggctgcaggctggacaggggtcccggccagagagcaccaacaacttccacagc
ctctatgtcaagaggcaccagggagtgagcgtgctgtatgctgacatcgtgggcttcacc
cggctggccagtgagtgctcccctaaggagctggtgctcatgctcaacgagctcttcggc
aagttcgaccagattgccaaggtgcccccccctccccctgcacacacacacactcccagg
agcatgaatgcatgcggatcaagatcctgggagactgttactactgtgtctctgggctac
cgctctccctgccagaccacgccatcaactgcgtgcgcatggggctggacatgtgccggg
ccatcaggtcagctcaggaaactccgggcggccactggcgtggacatcaacatgcgtgtg
ggcgtgcactcgggcagtgtgctctgcggagtcatcgggctgcagaagtggcagtatgat
gtctggtcccatgatgtcacactggccaaccacatggaggcgggcggcgtgccaggacga
gtacatatcacaggggctaccctggccctgctggccggggtctatgctgtggaagatgca
tcgatggaacaccgggacccataccttcgggagctaggggagcccacttacctggtcatc
gacccccgggctgaggaggaggaggagaagggcactgcgggagggctgctgtcctctctc
gagggcccccagatgcgcccatcactgctgatgacccgctacctggagtcctggggcgcg
gccaagccttttgcccacctgagccacctagagagccctgtgtccacttccacccctctc
ccggagaaggccctggcctccttcagcccccaatggagcctggaccggagccgtaccccc
cggggactagatgaggacctggacactggggacgccaagttcttccaggtcatcgaacag
ctcaactctcagaagcagtggaagcagtcaaaggacttcaacccactgacactgtacttc
agagagaaggagctggagaaagagtatcgactttctgccctccccgccttcaaatactat
gcggcctgcaccttcctggtcttcttctccaatttcatcatccagatgctggtgaccaac
aggcccccagctctggccgtcacctatagcatcaccttcctcctcttcctcctccttctc
ttcgtctgcttctcagagcacctgacgaagtgtgtcttgaaaggccccaagatgctgcac
tggctgcccgcactgtctggcttggtggccacacggcccggactccgagttgccctgggc
actgccaccatcctcctcgtttttgtcatggctattaccagcctgttcttcttaccggca
gcaacaaactgcccttccggggcttccaatgtgtcctccgtggcttccaacctctcctgg
gagctccctggctccctgcctctcatcagcgtcccatactctatgcactgctgcgtgctg
gggttcctgtcttgctccctctttctgcacatgagcttcgagctgaagttgctgttgctc
ctgctgtggctgggggtctcctgctccctcttcctgcactcccacgcctggctgtccgac
tgcctcatcgcccgcctctatccagatcccttggactccaggccaggggtgctaaaggag
cccaaagtgatgggagctatctccttcttcatcttcttcttcaccctccttgtcctggct
cggcagaatgagtattactgccgcctggacttcctgtggaagaagaagctgcggcaggag
caggaggagacagagaccatggagaacctgactcggctgctgctggagaatgtgctccct
gcgcacgtggcgccccagttcattggccagaaccggcgcaacgaggacctctaccaccag
tcctacgagtgtgtctgtgtcctcttcgcctcagttccagactttaaggagttttactct
gaatccaacatcaaccacgagggtctagagtgtctgcggttgctcaatgagatcatcgct
gattttgatgagctgctctcaaagcccaagtttagcggggtggagaagatcaaaaccatc
gggagcacctacatggcagccacgggcttaaatgccacccccggacaggatgcacagcag
gatgccgagcgaagctgcaaccacctgggcaccatggtggagttcgcagtggccctcgga
tcgaagctggatgtcatcaacaagcactcattcaacaacttccgcctgcgtgtggggttg
aaccacggacctgtagtggctggagtgattggggcccagaagcctcagtatgacatctgg
ggtaacacggtgaatgtggccagccgcatggaaagtacgggagtcctgggcaagatccaa
gtgactgaagagacagcccgggtgctgcaatccttaggctatacgtgctacagccggggc
atcatcaaggtcaaaggcaaagggcagctctgcacctacttcctgaacacagatttgaca
cgaactggccctccctcggccaccctaggctga

DBGET integrated database retrieval system