KEGG   Ailuropoda melanoleuca (giant panda): 100472906Help
Entry
100472906         CDS       T01329                                 

Gene name
PDIA3
Definition
(RefSeq) protein disulfide isomerase family A member 3
  KO
K08056  protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04141  Protein processing in endoplasmic reticulum
aml04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100472906 (PDIA3)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    100472906 (PDIA3)
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    100472906 (PDIA3)
Enzymes [BR:aml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100472906 (PDIA3)
Chaperones and folding catalysts [BR:aml03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100472906 (PDIA3)
Membrane trafficking [BR:aml04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100472906 (PDIA3)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100472906 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   100472906 (PDIA3)
  Exosomal proteins of bladder cancer cells
   100472906 (PDIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 AhpC-TSA OST3_OST6 Thioredoxin_3 DUF5394
Motif
Other DBs
NCBI-GeneID: 100472906
NCBI-ProteinID: XP_002913224
Ensembl: ENSAMEG00000015247
UniProt: D2GW48
Position
Un
AA seq 505 aa AA seqDB search
MRPRCHALFPGVALLFAAAGVAFASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEEEFEKFISDKDASVVGFFKDLFSEAHSEFLKAASNLRD
NYRFAHTNVESLVNKYDDDGEGITLFRPSHLMNKFEDKTVAYIEQKMTSGKIKKFIQENI
FGICPHMTEDNKDLIQGKDLLVAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGNKLSFA
VASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGN
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNDENKDVLIEFYAPWCGHCKNLEPKYKELG
EKLRKDPNIIIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYL
QREATNPPIIQEEKTKKKKKAQEDL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccccgctgccatgcgctgttcccgggcgtggcgctgcttttcgctgcggccggt
gtcgcctttgcctccgacgtgctggaactcactgacgacaacttcgagagtcgcatctcc
gacacgggctctgcgggcctcatgctcgtcgagttcttcgccccttggtgtggacactgc
aagaggcttgcccctgagtatgaagcagcagcaaccagattaaaaggaatagtcccatta
gcaaaggttgattgtactgccaacacgaacacctgtaataagtatggagtcagtggatat
ccaaccttgaagatatttagagatggtgaagaagctggtgcttatgatgggcccaggact
gccgatggaattgtcagccacctgaagaagcaggcaggaccagcttcggttcctctcagg
actgaggaagaatttgagaagttcattagtgacaaagatgcttctgtggtgggttttttc
aaagatttattcagtgaagctcactctgagtttctaaaagcagccagcaacttgagggat
aactaccgatttgcacacaccaatgtggagtctctggtgaacaaatatgatgatgatgga
gaaggtatcaccttgtttcgtccttcacatttaatgaacaagtttgaggacaagactgtg
gcatatatagaacagaaaatgactagtggcaagattaaaaaatttatccaagaaaatatt
tttggaatctgccctcacatgacagaagacaataaagatttgatacagggcaaggactta
cttgtggcttactatgatgttgactatgaaaagaacgctaaaggttctaactactggaga
aacagagtgatgatggtagcaaagaaattcctagatgctggaaacaaactcagctttgct
gtagctagccgcaaaacctttagccacgaactttctgattttggcttggaaagcactgct
ggagagattcctgttgttgctatcagaactgcaaaaggagagaagtttgtcatgcaagag
gagttctcgcgggatggcaaggctcttgaaagattcctgcaggattactttgatggcaac
ctgaagagatacctgaagtctgagcccatcccggagagcaatgatgggccggtaaaggta
gtggtagcagagaattttgatgaaatagtgaatgacgaaaataaagatgtactgattgaa
ttttatgctccttggtgtggtcactgtaagaatctggaacccaagtataaagaactggga
gaaaagctcagaaaagacccaaatattatcatagccaagatggatgccacagccaatgat
gtgccttctccatatgaagtcagaggttttcctaccatctacttctctccagccaacaag
aagctaaatccaaagaaatacgaaggtggccgtgaattaagtgattttattagctatcta
caacgagaggcaacaaatccccctataattcaagaagaaaaaactaagaagaagaagaag
gcacaggaggatctctaa

DBGET integrated database retrieval system