KEGG   Ailuropoda melanoleuca (giant panda): 100473604Help
Entry
100473604         CDS       T01329                                 

Gene name
DLST
Definition
(RefSeq) dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00020  Citrate cycle (TCA cycle)
aml00310  Lysine degradation
aml01100  Metabolic pathways
aml01200  Carbon metabolism
Module
aml_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100473604 (DLST)
  Amino acid metabolism
   00310 Lysine degradation
    100473604 (DLST)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100473604 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 100473604
NCBI-ProteinID: XP_002914745
Ensembl: ENSAMEG00000018307
UniProt: G1MJ14
Position
Un
AA seq 454 aa AA seqDB search
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGISLCQGPGYPDSRKIVINNSSVFNVRF
FRTTAVCKDDVITVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPA
NGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKARPAEAPAAAPTAEPPVSAVPPPPAAP
IPTQMPPMPSPSQPLASKPVSAVKPAAAPPVAEPGAGKGLRSEHREKMNRMRQRIAQRLK
EAQNTCAMLTTFNEIDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVVN
AVIDDATKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNYADIERTISELGEKARKNEL
AIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIFDRPVAVGGKVEVRPMMYVA
LTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccggtctcgctgcgtgtctcgggcgttcagccgctcgctctccgccttccag
aaggggaactgcccgctagggagacgttccctgcctgggatctccttatgtcagggacca
ggttaccctgacagcaggaagattgttattaacaacagtagtgtcttcaatgttcgcttc
ttcagaactacagctgtatgcaaggatgatgtgattacagtcaaaaccccagcgttcgca
gaatctgtcacagagggagatgtcaggtgggagaaagctgttggagacaccgttgcagaa
gacgaagtggtttgtgagattgaaactgacaagacatctgtacaggttccgtcaccagca
aatggcgtgattgaagctcttttggtacctgatgggggaaaagtagaaggaggcactcct
cttttcacactcaggaaaactggcgctgctcctgcgaaggccaggccagccgaagctcct
gccgcagccccgacagcagagcctccagtgtcggcagttcctcctcccccggcagcaccc
atacccactcagatgccaccaatgccctcgccctcccaacctcttgctagcaaaccggtg
tctgcagtgaaacccgctgctgctcctccagtagccgagccaggagctggcaagggcctg
cgctcagaacatcgggagaaaatgaacaggatgcggcagcgcatcgcccagcgtctgaag
gaggcgcagaacacatgtgcgatgctcactactttcaatgagatcgacatgagtaacatc
caggagatgagggctcggcacaaagatgcttttctgaagaaacataacctcaaactaggc
ttcatgtcggcattcgtgaaggcctcagccttcgccttgcaggagcagcctgtggtcaat
gcagtgattgatgacgcaaccaaagaggtggtgtacagggattatattgacatcagtgtt
gcggtggccaccccacggggtctggtggttcctgtcatcaggaacgtcgaagctatgaat
tacgcagatatcgagcgaaccatcagcgaactgggagagaaggcccgaaagaatgaactt
gccattgaagatatggacggtggtactttcaccattagcaacggaggtgttttcggctcg
ctctttggaacgcccatcatcaacccccctcagtcggccatcctgggcatgcacgccatc
tttgataggccagtggctgtgggaggcaaggtggaggtgcggcccatgatgtacgtggca
ctgacctacgatcaccggctgatcgatggcagagaggcggtcactttcctccgcaagatc
aaggcagcggtagaggatcccagagtcctcctcctggacctttag

DBGET integrated database retrieval system