KEGG   Ailuropoda melanoleuca (giant panda): 100473644
Entry
100473644         CDS       T01329                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X2
  KO
K04829  acid-sensing ion channel 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100473644 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aml04040]
    100473644 (ASIC1)
Ion channels [BR:aml04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   100473644 (ASIC1)
SSDB
Motif
Pfam: ASC EFP
Other DBs
NCBI-GeneID: 100473644
NCBI-ProteinID: XP_002922431
Ensembl: ENSAMEG00000001129
Position
16
AA seq 558 aa
MSRTFMSSPPPASQPWVSRFPVTHHTRIPLVRMELKAEEEEVGGVQPVSIQAFASSSTLH
GLAHIFSYERLSLKRALWALCFLGSLAVLLCVCTERVQYYFHYHHVTKLDEVAASQLTFP
AVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFK
PKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLK
TMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPG
FQTFVSCQEQRLIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYLVENCNCRMVHM
PGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYL
AKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTV
LELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYA
ANILPHHPARGTFEDFTC
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgtcaagaaccttcatgtcctcacctccgcctgcttcccagccttgggtctcacgattc
cccgtcacccaccacacaaggatccccttggtcaggatggaactgaaggccgaggaggag
gaggtgggtggcgtccagccggtgagcatccaggccttcgccagcagctccacgctgcac
ggcctggcccacatcttctcctacgaacggctgtctctgaagcgggcgctctgggccctg
tgcttcctgggctcactggctgtgctgctgtgcgtgtgcacggagcgagtgcagtactac
tttcactaccaccacgtcaccaagctcgatgaggtggctgcctcccagctcaccttcccc
gccgtcacactgtgcaatctcaacgagttccgctttagccaagtctccaagaatgacctg
taccacgctggggagctgctggccctgctcaacaacaggtatgagataccggacacacag
atggcagatgaaaagcagctggagatcctgcaggacaaggccaacttccgcagcttcaag
cccaagcccttcaacatgcgggagttctacgaccgtgcagggcatgacattcgagacatg
ctgctctcctgccacttccggggggaggtctgcagcgctgaagacttcaaggtggtcttc
acacggtatggcaagtgctatacattcaactccggccgagatgggcgtccacggctgaag
accatgaagggtgggactggcaatgggctggagatcatgctggacatccagcaggacgag
tacctgcctgtatggggagagactgatgagacgtccttcgaagcgggcatcaaagtgcag
atccacagtcaggatgaacctcccttcatcgaccagctgggctttggtgtggccccaggg
ttccagacctttgtgtcctgccaggagcagcggctcatctacctgcccccgccctggggc
acctgcaaagctgttaccatggactcggatttcttcgactcctacagcattactgcctgc
cgcattgactgtgagacacgctacctggtggagaactgtaactgtcgcatggtgcacatg
ccaggggacgccccgtactgcactccagaacagtacaaggagtgtgcggaccctgcttta
gacttcctggtggagaaggaccaggagtactgtgtgtgtgaaatgccatgcaacctaacc
cgctatggcaaggagctgtccatggtcaagatccccagcaaagcatcagccaagtacctg
gccaagaagttcaacaagtctgagcagtacataggggagaacatcctggtgctggacatt
ttctttgaagtcctcaactatgagactattgagcagaagaaggcctatgaaattgcaggc
ctcctgggtgacattgggggccaaatggggctgttcattggggccagcatcctcacggtt
ctggagctcttcgactatgcttatgaggtcattaagcacaagctgtgcagaagaggaaag
tgccagaaggaggccaaacggagcagcgctgacaagggtgtggcccttagcctggatgac
gtcaaaagacataacccatgtgagagcctccggggccaccctgctgggatgacgtatgct
gccaacatcctacctcaccatccggcccgaggcacttttgaggactttacctgctga

DBGET integrated database retrieval system