KEGG   Ailuropoda melanoleuca (giant panda): 100473767
Entry
100473767         CDS       T01329                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01524  Platinum drug resistance
aml04010  MAPK signaling pathway
aml04060  Cytokine-cytokine receptor interaction
aml04115  p53 signaling pathway
aml04210  Apoptosis
aml04217  Necroptosis
aml04650  Natural killer cell mediated cytotoxicity
aml04668  TNF signaling pathway
aml04932  Non-alcoholic fatty liver disease
aml04940  Type I diabetes mellitus
aml05010  Alzheimer disease
aml05142  Chagas disease
aml05143  African trypanosomiasis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05320  Autoimmune thyroid disease
aml05330  Allograft rejection
aml05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100473767 (FAS)
   04668 TNF signaling pathway
    100473767 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100473767 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100473767 (FAS)
   04217 Necroptosis
    100473767 (FAS)
   04115 p53 signaling pathway
    100473767 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100473767 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100473767 (FAS)
   05205 Proteoglycans in cancer
    100473767 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100473767 (FAS)
   05330 Allograft rejection
    100473767 (FAS)
   05332 Graft-versus-host disease
    100473767 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100473767 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100473767 (FAS)
   04932 Non-alcoholic fatty liver disease
    100473767 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100473767 (FAS)
   05162 Measles
    100473767 (FAS)
   05164 Influenza A
    100473767 (FAS)
   05161 Hepatitis B
    100473767 (FAS)
   05160 Hepatitis C
    100473767 (FAS)
   05168 Herpes simplex virus 1 infection
    100473767 (FAS)
   05163 Human cytomegalovirus infection
    100473767 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100473767 (FAS)
   05169 Epstein-Barr virus infection
    100473767 (FAS)
   05165 Human papillomavirus infection
    100473767 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100473767 (FAS)
   05143 African trypanosomiasis
    100473767 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100473767 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:aml04050]
    100473767 (FAS)
   04090 CD molecules [BR:aml04090]
    100473767 (FAS)
Cytokine receptors [BR:aml04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100473767 (FAS)
CD molecules [BR:aml04090]
 Proteins
  100473767 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6 CcmH SIT Stn1_C
Other DBs
NCBI-GeneID: 100473767
NCBI-ProteinID: XP_034518293
Position
6
AA seq 371 aa
MGTGPEFRAPCWDRVSAARPPRAEGDAFIPVSQRAGWRPASSSSSRAPAARLSGRAGTSV
RPISKVQILTSIARPWPKGVNAQATAIDSRLLRVRKNITIRETGCPEGLHRGDTFCCQPC
PPGTRKEGDCKSERGESICVLCQEGVEYTEEKHFSDKCRRCTLCDGEHGLEVEKNCTRTQ
NTKCRCKPNFFCNVSECGHCTPCTTCEHGILESCTPTSNTKCKEGSSSKFLWFCVLIPIL
IAALICWWMLRRRRKKSHEVRRSTGSATEMMPINFADIDLSKYITSVSEQMTITQVREFV
RKNGINEAKIDEIKNDNLQDTAEQKVQLLRNWYQLHGKKDAYCNLIRGLRKANFCALAER
IEEMIQRDITS
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggggaccggccctgagttccgcgcaccgtgctgggaccgtgtgtcagcggcgcgcccg
ccgcgggctgagggcgatgccttcatccccgtttcacagagggccggatggaggccggca
agctcaagtagcagccgagctcccgcagcgcgtctaagtggcagagctgggacttcagtt
agacctatttccaaagtccagatacttacctccatcgcccgaccgtggcctaaaggtgtc
aatgctcaagcaactgccatcgattccaggctgttgagagtgcggaagaacattaccata
agggagacggggtgcccggaaggcctgcatcgtggggacacgttctgctgtcagccgtgt
cctcctggcacacggaaagagggcgactgcaagtctgagaggggtgaatcaatatgtgtg
ctctgccaggaaggggtggagtacacggaggagaagcatttttctgataaatgcagaaga
tgcacactttgcgatggagagcatggcttggaagtggaaaaaaactgtacccggacccag
aataccaagtgcaggtgtaaaccaaactttttttgtaacgtctctgaatgcggacactgt
accccgtgcaccacgtgtgaacacggaatccttgagagttgcacaccaaccagcaatacc
aaatgcaaagaaggatccagctccaaatttctgtggttttgtgtcctaatcccgattctt
atagctgcactaatatgttggtggatgttaagacggcgcaggaagaaaagccatgaagtc
cgtcgatccacaggctcagccactgaaatgatgccaataaattttgcagacatcgacctg
agtaaatatatcactagtgtttctgaacaaatgacaataactcaagtcagagaatttgtt
cggaagaatggtatcaacgaagccaagatagatgagatcaagaatgacaatctccaagac
acagcggaacagaaagtccagttgctccgtaattggtatcaactccacgggaagaaagat
gcatattgcaatttaattagaggcctcagaaaagccaatttttgtgcactagcagagaga
attgaagaaatgatccagagggacattactagctaa

DBGET integrated database retrieval system