KEGG   Ailuropoda melanoleuca (giant panda): 100473777Help
Entry
100473777         CDS       T01329                                 

Gene name
GLS
Definition
(RefSeq) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00220  Arginine biosynthesis
aml00250  Alanine, aspartate and glutamate metabolism
aml00471  D-Glutamine and D-glutamate metabolism
aml01100  Metabolic pathways
aml04724  Glutamatergic synapse
aml04727  GABAergic synapse
aml04964  Proximal tubule bicarbonate reclamation
aml05206  MicroRNAs in cancer
aml05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100473777 (GLS)
   00220 Arginine biosynthesis
    100473777 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100473777 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100473777 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    100473777 (GLS)
   04727 GABAergic synapse
    100473777 (GLS)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100473777 (GLS)
   05206 MicroRNAs in cancer
    100473777 (GLS)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100473777 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_2 Ank_4 Ank_3 Ank_5 Ank
Motif
Other DBs
NCBI-GeneID: 100473777
NCBI-ProteinID: XP_019653877
Ensembl: ENSAMEG00000014002
Position
Un
AA seq 674 aa AA seqDB search
MMRLRGSAMLRDLLLRPPPASCAALRRAQPLATQCRRPRGGGQGAAGPXXXXXXXXXXXX
XXXXXXXXXGPLARGLSSSPSEILQELGKGSPQQQQPGASPPAAPSAPGPKDGPGETDAF
GSSEGKELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRL
KECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELF
ESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAI
AVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKF
DYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYF
QLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFH
VGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRH
FAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAA
EGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQGQYTPQGDSGNG
KENQTVHKNLDGLL
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgactgcgaggctcggcaatgctgcgggacctgctcctgcggcctccccccgcc
tcctgcgcggctctgaggcgggcacagcccctcgccacacagtgccggcgtccccgaggc
gggggacagggggccgcgggtccannnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnggggcccctcgcgcggggactgtctagctccccc
tcggagatcctgcaggagctgggcaaggggagcccgcagcagcagcaacccggggcgtcg
ccgcccgcggccccgtcggctcccggccccaaggacggacccggggagacggacgcgttc
ggcagcagtgagggcaaggagctggtggcctcaggcgaaaataaaataaaacagggtctg
ttacctagcttggaagatttgctgttctatacaattgcagaaggacaagagaaaatacct
gttcataaatttattacagcactcaaatctacaggattgcgaacgtctgatcccaggttg
aaagagtgtatggatatgttaagattaactcttcaaacaacatcagatggtgtcatgcta
gacaaagatctttttaaaaaatgcgttcagagcaatattgttttgttgacacaagccttt
agaagaaagtttgtcattcctgactttatgtcttttacttctcacattgatgagttattt
gaaagtgctaaaaagcagtctggaggaaaggttgcagattatattcctcagctagccaag
ttcagtcctgatttgtggggtgtgtctgtgtgtacagtagatggacagaggcattctatt
ggagataccaaagttccattttgtcttcagtcctgtgtaaaacctttgaaatatgccatt
gctgttaatgatcttggaacagaatatgtgcatcgatatgttgggaaagagccaagtgga
ttaagattcaacaaactgtttttaaatgaagatgataagccacataatcctatggtaaat
gctggagcaattgtcgtgacttcattaataaagcaaggagtgaataatgctgaaaaattt
gactatgtgatgcagtttttgaataagatggctggcaatgaatatgttggattcagtaat
gcaacgtttcagtctgaaagagaaagtggagatcgaaattttgcaataggatattaccta
aaagaaaaaaagtgttttccagagggcacagacatggttggtatattagacttctatttc
cagctatgctccattgaagtaacttgtgaatcagccagtgtaatggctgcaacactggct
aatggtggtttctgtccaattactggtgagagagtactgagccctgaagcagttcgaaat
acactgagtttgatgcattcctgtggcatgtatgatttctcagggcagtttgctttccat
gttggtcttcctgcaaaatctggagttgctgggggcattcttttagttgtccccaatgtc
atgggcatgatgtgctggtctcctcctctggacaagatgggcaacagtgttaagggaatt
catttctgtcacgatcttgtttctctctgtaatttccataactatgataatctgagacac
tttgcaaaaaaacttgatcctcgaagagaaggtggtgatcaaagggtgaagtcagtgata
aacctgttgtttgctgcgtacactggagacgtgtctgcacttcgaagatttgctctgtca
gccatggacatggaacagcgagactatgactctaggacagccctccatgtagctgctgcg
gagggtcatgttgaagttgtcaaatttttgctggaagcgtgcaaagtaaaccctttcccc
aaggacaggtggaataacacgcccatggacgaagcgctgcacttcggacaccacgatgtg
tttaaaatcctccaggagtaccaaggccagtacacgccccagggagattccggcaacgga
aaagaaaatcaaacggtccataagaatcttgacggattgttataa

DBGET integrated database retrieval system