KEGG   Ailuropoda melanoleuca (giant panda): 100473956Help
Entry
100473956         CDS       T01329                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04072  Phospholipase D signaling pathway
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04520  Adherens junction
aml04910  Insulin signaling pathway
aml04913  Ovarian steroidogenesis
aml04923  Regulation of lipolysis in adipocytes
aml04930  Type II diabetes mellitus
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease (NAFLD)
aml04960  Aldosterone-regulated sodium reabsorption
Module
aml_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100473956 (INSR)
   04015 Rap1 signaling pathway
    100473956 (INSR)
   04010 MAPK signaling pathway
    100473956 (INSR)
   04066 HIF-1 signaling pathway
    100473956 (INSR)
   04068 FoxO signaling pathway
    100473956 (INSR)
   04072 Phospholipase D signaling pathway
    100473956 (INSR)
   04022 cGMP - PKG signaling pathway
    100473956 (INSR)
   04151 PI3K-Akt signaling pathway
    100473956 (INSR)
   04152 AMPK signaling pathway
    100473956 (INSR)
   04150 mTOR signaling pathway
    100473956 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100473956 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100473956 (INSR)
   04923 Regulation of lipolysis in adipocyte
    100473956 (INSR)
   04913 Ovarian Steroidogenesis
    100473956 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100473956 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    100473956 (INSR)
   04213 Longevity regulating pathway - multiple species
    100473956 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100473956 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100473956 (INSR)
   04931 Insulin resistance
    100473956 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100473956 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:aml04090]
    100473956 (INSR)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100473956 (INSR)
Protein kinases [BR:aml01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100473956 (INSR)
CD molecules [BR:aml04090]
 Proteins
  100473956 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 100473956
NCBI-ProteinID: XP_019658049
Ensembl: ENSAMEG00000008175
Position
Un
AA seq 1364 aa AA seqDB search
MACLLTCLAFCLFSPLVCPGMDIRNNLTRLHELANCSVIEGHLQILLMFKTRPEDFRDLS
FPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVVFEMVHLKELGLYSLM
NITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCP
ATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSEPDDPTKCVACRN
FYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHNKCKNSRRQGCHQYVIHNNKCIPECPS
GYTMNSSNLMCTPCLGPCPKVCHILEGEKTIDSVTSAQELRGCTVVNGSLIINIRGGNNL
AAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQ
LWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCEN
ELLKFSYIRTSYDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWT
VVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQT
DATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELYELDYCLKG
LKLPSRTWSPPFEAEGSQKHNQSEYEESAGECCSCPKTDSQILKELEESSFRKTFEDYLH
NVVFVPRKSSSSPGAEDTRPSRKRRALGDGANVTAAAPTVPGFPNSSTSAPTSPEEHKPF
EKVVNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAAYVSARTMPEAKADDIVGPVT
HEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRRHFALERGCRLRGLPP
GNYSVRVRATSLAGNGSWTEATYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLF
LRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPREKISLLRELGQGSFGMVY
EGNARDIVKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQP
TLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHR
DLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSD
MWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPK
MRPTFLEIVDLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMESVPLDRASHSQRE
EAGGRDGGSSLGLKRNYEEHIPYTHMNGGKKNGRILTLPRSNPS
NT seq 4095 nt NT seq  +upstreamnt  +downstreamnt
atggcatgtttgctcacctgtcttgctttctgcttgttttcacctctagtgtgccctggc
atggatatccggaacaacctcacgaggttgcatgagctggccaactgctcagtcatcgaa
ggacatttgcagatactgttgatgttcaaaacgaggcccgaggatttccgagacctcagt
ttccccaaactcatcatgatcactgattacttgctgctcttccgggtctatgggctggag
agcctgaaggacctgttccccaacctcacggtcatccggggctcgcgtctcttcttcaac
tacgcgctggtcgtcttcgagatggttcacctgaaggagcttggcctttatagcttgatg
aacattaccaggggctccgtccgcattgagaagaataatgagctctgctacctggccacc
atcgactggtcgcgcatcctggattccgtggaggataattacattgtgctgaacaaagac
gacaatgaggagtgtggggacatctgtccaggcactgcaaagggcaagaccaactgcccc
gccactgtcatcaatgggcagtttgtcgagaggtgttggacacacagccactgccagaaa
gtttgtcccaccatctgcaagtcgcacggctgcaccgccgagggcctctgctgccacagc
gagtgtttaggcaattgctccgagcccgacgaccccaccaagtgcgtggcctgtcgcaac
ttctacctggatggcaggtgcgtggagacctgcccgcccccgtactatcacttccaagac
tggcgctgcgtgaacttcagcttctgccaggatttgcacaacaaatgcaagaactcccgg
agacagggctgccaccagtacgtcattcataacaacaagtgcatccccgagtgcccctct
ggctacacgatgaattccagcaacctgatgtgcaccccatgcctgggcccctgtcccaag
gtctgccacattctggagggcgagaagaccatcgactcggtgacctctgcccaggagctt
cgaggctgcactgttgtcaacggaagcctcatcatcaacattcgagggggcaacaacctg
gcagctgagctggaggccaaccttggactcattgaagaaatttccgggtatctgaaaatc
cggagatcctatgctcttgtgtccctttcctttttccggaagttacggctgattcgagga
gagaccttggaaatcgggaactactctttctacgccttggacaaccagaacctaaggcag
ctatgggactggagcaaacacaacctcactatcactcaggggaagctcttcttccactat
aatcccaaactctgcttgtcagaaattcacaagatggaggaagtttcaggaaccaagggg
cgccaggagaggaacgacattgccctgaagaccaatggggaccaggcgtcttgtgaaaac
gaactccttaagttttcttacatccggacatcatatgacaagatcttgctgaaatgggag
ccgtactggccccctgacttccgagacctcctgggtttcatgcttttctacaaagaggcc
ccttatcagaatgtgaccgagttcgatgggcaggatgcgtgtggctccaacagctggacg
gtggtggacattgacccgcctctgcggtccaatgaccccaagtcgcagaaccacccaggg
tggctgatgcggggtctcaagccctggacccagtatgccatctttgtcaagactttggtc
accttttctgatgaacgccgcacgtacggggccaagagtgacatcatctatgtgcagaca
gatgccactaacccttctgtccccctggatccaatctccgtctcaaattcctcgtcccag
attattctgaagtggaagcctccctctgaccccaacggcaacatcacacactacctggtt
ttctgggagaggcaggcagaagacagtgagctgtatgaattggattattgcctcaaaggg
ttgaagctgccctcccggacctggtctccgccgttcgaggccgagggctcgcagaagcac
aaccagagcgagtacgaggagtctgccggcgagtgctgttcctgccccaagacggactct
cagatcctcaaggagctggaggagtcctcgttcaggaagaccttcgaggattacctgcac
aatgtggtgttcgtccccagaaaatcctcttcaagccctggtgctgaggacactaggcca
tcgcggaaacgcagggccctcggtgacggtgccaatgtgacggcggccgcgcccacggtt
ccgggtttccccaacagctccaccagcgcacccacgagcccggaggagcacaagcccttc
gagaaagtggtgaacaaggaatccctggtcatctctgggctgcgtcacttcactggctac
cgcatcgagctgcaggcttgcaaccaagactccccggaggagaggtgcagcgtggcggct
tatgtcagcgccaggaccatgcccgaagctaaggcagacgacatcgttggccccgtgacc
cacgaaatcttcgagaacaacgttgttcacttgatgtggcaggagccaaaggaacccaac
ggtctgatcgtgttgtatgaagtgagttaccgacgttacggtgatgaggagctgcacctc
tgtgtctcccgcagacactttgctctggagcggggctgcaggctgcgcgggctgccgccg
gggaattatagcgtgcgagtccgggccacctccctggccggcaacggctcctggacagaa
gccacctacttctacgtgacagactatttagatgtcccatcgaatattgcaaaaatcatc
atcggccccctcatctttgtctttctcttcagtgttgtgattggaagtatttacctgttc
ctgagaaagaggcagccggatgggccactgggaccgctgtatgcttcttcaaaccccgag
tacctcagtgccagtgatgtatttccatgttctgtgtatgtgccggacgagtgggaggtc
ccccgggagaagatcagtctgctgcgtgagctggggcagggctccttcggcatggtgtac
gaaggcaacgccagagacatcgtcaagggcgaggcggagacccgcgtggcagtgaagacg
gtcaatgagtcggccagtctgcgggagaggattgagtttctcaacgaggcctccgtcatg
aagggcttcacctgtcatcacgtggtccgcctcctgggggtggtgtccaagggccagccg
acgctggtggtgatggagctgatggcccacggagacctgaagagctacctccgctccctg
cggccggaggctgagaataaccccggccgccctccccctaccctgcaagagatgattcag
atggcggcggagatcgccgacgggatggcctacctgaacgccaagaagttcgtgcaccgg
gatctcgcggcccgaaactgcatggtcgcccacgacttcaccgtcaaaattggagacttt
gggatgaccagagacatctatgaaacggattactaccggaaaggaggcaagggtctgctc
cctgtgcggtggatggccccggaatccctgaaggacggggtctttaccacttcttctgac
atgtggtcctttggcgtggtcctttgggaaatcaccagcttggcagaacagccgtaccag
ggtctgtctaatgaacaggtgttgaaattcgtcatggatggagggtatctggatcaacct
gacaattgtccagagagagtcaccgacctgatgcgcatgtgctggcagttcaatcccaag
atgcggcccaccttcctggagatcgtcgacctgctcaaggacgacctgcatcctagcttt
ccggaagtttccttcttccacagcgaggagaacaaggcgcctgagagcgaggagctggag
atggagttcgaggacatggagagtgtccccctggatcgggcctcacactctcagagggag
gaggctgggggccgggatggagggtcctccctgggcctcaagcgaaactacgaggagcac
atcccctacacccacatgaacgggggcaagaaaaacggacggattctgacgctgccgagg
tcgaatccttcctaa

DBGET integrated database retrieval system