KEGG   Ailuropoda melanoleuca (giant panda): 100474240Help
Entry
100474240         CDS       T01329                                 

Gene name
GPX6
Definition
(RefSeq) glutathione peroxidase 6
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00480  Glutathione metabolism
aml00590  Arachidonic acid metabolism
aml01100  Metabolic pathways
aml04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100474240 (GPX6)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100474240 (GPX6)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    100474240 (GPX6)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100474240 (GPX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 100474240
NCBI-ProteinID: XP_002928690
Position
Un
AA seq 218 aa AA seqDB search
MRPQLWASWLFPLFLAGLAQPTQKMKMDCYKGVTGTIYEYGALTLNDEEYIQFKHYAGKH
VLFVNVATYUGLTAQYPELNALHQELKPFGVVVLGFPCNQFGKQEPGKNSEILSGLKYVR
PGGGFVPNFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSSNQLFWEPMKVHDIRWNF
EKFLVGPDGVPVMRWFHKAPVSTVKSDILEYLKQFKTE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgcagctctgggcttcgtggcttttcccgctgtttctggccggcctcgcccag
ccgacccagaagatgaagatggattgctacaagggggtgacgggcaccatctatgagtat
ggggccctcaccctcaatgacgaggagtacattcagttcaagcactacgcgggcaagcac
gtcctctttgtcaacgtggccacctactgaggcttgacagctcagtatccagaactgaat
gcactacaccaggagctcaagccttttggtgtcgtcgtgctgggctttccctgcaaccaa
tttggaaaacaagaaccaggaaagaactcagagatcctttctgggctcaagtatgtgcgt
ccaggtggtggctttgtccccaattttcagctctttgagaaaggggatgtgaatggagaa
aaagaacagaaggtctttactttcctgaagaactcctgccctccaacctctgaccttttg
ggctcatcaaaccaactcttctgggagcccatgaaggtccacgacatccgctggaacttt
gagaagttcctggtggggcctgacggagtccctgtcatgcgctggttccacaaggctccc
gtcagcacggtcaagtcagacatcctggagtacctgaaacagttcaaaaccgagtag

DBGET integrated database retrieval system