KEGG   Ailuropoda melanoleuca (giant panda): 100474396Help
Entry
100474396         CDS       T01329                                 

Gene name
SOS2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04062  Chemokine signaling pathway
aml04068  FoxO signaling pathway
aml04072  Phospholipase D signaling pathway
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04510  Focal adhesion
aml04540  Gap junction
aml04630  Jak-STAT signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04714  Thermogenesis
aml04722  Neurotrophin signaling pathway
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04912  GnRH signaling pathway
aml04915  Estrogen signaling pathway
aml04917  Prolactin signaling pathway
aml04926  Relaxin signaling pathway
aml05034  Alcoholism
aml05160  Hepatitis C
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100474396 (SOS2)
   04010 MAPK signaling pathway
    100474396 (SOS2)
   04012 ErbB signaling pathway
    100474396 (SOS2)
   04630 Jak-STAT signaling pathway
    100474396 (SOS2)
   04068 FoxO signaling pathway
    100474396 (SOS2)
   04072 Phospholipase D signaling pathway
    100474396 (SOS2)
   04151 PI3K-Akt signaling pathway
    100474396 (SOS2)
   04150 mTOR signaling pathway
    100474396 (SOS2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100474396 (SOS2)
   04540 Gap junction
    100474396 (SOS2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100474396 (SOS2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100474396 (SOS2)
   04660 T cell receptor signaling pathway
    100474396 (SOS2)
   04662 B cell receptor signaling pathway
    100474396 (SOS2)
   04664 Fc epsilon RI signaling pathway
    100474396 (SOS2)
   04062 Chemokine signaling pathway
    100474396 (SOS2)
  Endocrine system
   04910 Insulin signaling pathway
    100474396 (SOS2)
   04912 GnRH signaling pathway
    100474396 (SOS2)
   04915 Estrogen signaling pathway
    100474396 (SOS2)
   04917 Prolactin signaling pathway
    100474396 (SOS2)
   04926 Relaxin signaling pathway
    100474396 (SOS2)
  Nervous system
   04722 Neurotrophin signaling pathway
    100474396 (SOS2)
  Environmental adaptation
   04714 Thermogenesis
    100474396 (SOS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100474396 (SOS2)
   05231 Choline metabolism in cancer
    100474396 (SOS2)
   05206 MicroRNAs in cancer
    100474396 (SOS2)
   05205 Proteoglycans in cancer
    100474396 (SOS2)
   05210 Colorectal cancer
    100474396 (SOS2)
   05225 Hepatocellular carcinoma
    100474396 (SOS2)
   05226 Gastric cancer
    100474396 (SOS2)
   05214 Glioma
    100474396 (SOS2)
   05221 Acute myeloid leukemia
    100474396 (SOS2)
   05220 Chronic myeloid leukemia
    100474396 (SOS2)
   05211 Renal cell carcinoma
    100474396 (SOS2)
   05215 Prostate cancer
    100474396 (SOS2)
   05213 Endometrial cancer
    100474396 (SOS2)
   05224 Breast cancer
    100474396 (SOS2)
   05223 Non-small cell lung cancer
    100474396 (SOS2)
  Substance dependence
   05034 Alcoholism
    100474396 (SOS2)
  Infectious diseases
   05160 Hepatitis C
    100474396 (SOS2)
   05165 Human papillomavirus infection
    100474396 (SOS2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100474396 (SOS2)
   01522 Endocrine resistance
    100474396 (SOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_13
Motif
Other DBs
NCBI-GeneID: 100474396
NCBI-ProteinID: XP_019658125
Ensembl: ENSAMEG00000009734
Position
Un
AA seq 1275 aa AA seqDB search
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPRSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
DRIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCECKHAFELVSKDENSIVFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
VEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPTEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAILSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKMSFSRIAETDIESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLSSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFEDDASNSKGNTKSDDDPPAIPPRQPPPPKVKPRAPAPTGAFDGPL
HSPPPPPPRDPLPDTPPPVPLRPPEHFLNCPFNLQPPPLGHLHRDPDWFRDVSTCPNSPN
TPPSTPSPRVPRRCYVLSSSHNHLAHPQAPPVPPRQSSSPHLPNLPKLPPKTYKRELSHP
PSFRLPVLENAETPQ
NT seq 3828 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaccaaggactgttcaagatgtggaggaacgtgttcaaaagacctttcctcat
ccaattgataaatgggctattgctgatgcacaatctgccatagaaaaacgaaaacgaaga
aatcctctcttacttcctgtggacaaaatccatccttcattgaaggaagttttagggtac
aaagtggactatcatgtatccctatatattgtggctgtgctagagtatatctcagctgat
attttgaagttggctggtaattatgtttttaatatccgacattatgaaatatctcagcag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggtttggtttctctctgtgaagacgaacctcgttcttcaggcgaattaaactactat
gaccttgtcagaaccgaaattgcggaagaaaggcagtatctacgggaactcaatatgatc
attaaagtgtttcgagaagcctttctttctgacagaaagctgtttaaaccttctgatatt
gacaggattttcagtaacatttcagatatacatgaattaactgtgaaacttttaggtttg
attgaagacacagttgaaatgactgatgaaagcagtcctcatccgttagcgggcagctgt
tttgaagatttggcagaagagcaagcatttgatccttatgaaacattatcacaggacatt
ctttctccaaaatttaatgaacattttagtaagttgatggccagacctgcggtggctcta
cactttcagtccattgctgatggttttaaagaggcagttcgttatgtccttccacgcctt
atgctggtgcctgtttatcattgttggcactattttgaattattaaagcaattgaaagca
tgtagtgaagagcaggaagacagagaatgtttgaaccaagctattaccgctcttatgaat
ctccaaggtagtatggaccggatttacaagcagtattcacctagacgccgacctggggat
cctgtttgccctttttataatcgtcagttaagaagcaagcatctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaagggaaagatattggacagtgttgtaat
gaattcattatggaaggcccattgacacgaattggtgctaaacatgaacgacatattttt
ctcttcgatggcttaatgattagctgtaaacccaatcatagtcagtcacgccttccaggt
tatagtagtgcagaatacagattaaaagagaaatttgtcatgaggaaaatacaaatatgt
gataaagaagatacttgtgagtgcaaacatgcttttgagttggtatccaaagatgaaaac
agcatagtatttgctgctaagtctgccgaagagaaaaacaattggatggccgcacttatt
tctcttcactatcgtagtacactagatcgaatgctagattcagtgttattgaaagaagaa
aatgagcaaccattgagattaccaagtcctgaagtgtatcgttttgtggtaaaagactct
gaggaaaacattgtttttgaagacaacctgcaaagtagaagtggaatccccattattaaa
ggaggaactgtagtgaaattaattgaaaggttaacatatcatatgtatgcagatcccaat
tttgttcgtacttttcttactacataccgttcattttgtaaaccacaggaattgctaagc
ttactgattgaacgatttgaaattccagagccagaacctactgaagcagataaattggcc
gtagagaaaggcgaacagccgatcagcgcagaccttaaaaggtttcgcaaggaatatgtg
caaccagtacagcttaggatcttaaatgtgtttcggcactgggttgaacaccatttttat
gactttgaaagggatttggagttgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagctatgaagaagtgggtagagtcaattgctaagatcatcaagagaaagaaacaa
gctcaggcaaatggaataagccataatattacctttgaaagtccacctccaccaactgaa
tggcatatcagcagaccagggcagtttgaaacatttgacctcatgacccttcatccaata
gaaattgcacgtcagctgacacttttggaatctgatctctacaggaaagtccaaccttct
gaactagtagggagtgtatggacgaaagaagataaagaaataaattctccaaatttgtta
aaaatgattcgccataccacaaacctcaccttatggtttgaaaagtgtattgtggaagca
gaaaattttgaggaacgggtggcaatactaagtagaattatagaaattctgcaagttttt
caagatttgaataacttcaatggtgtattggagatagtcagtgcagtaaattcagtgtcg
gtatacagactagaccatacttttgaggcattgcaggaaagaaaaaggagaattttggat
gaagctgtggaattaagtcaagatcactttaaaaaatacctggtaaaacttaagtcaatc
aatccaccttgcgtgcctttttttggaatatatttaacaaatattctgaaaactgaagaa
gggaataatgattttttaaaaaagaaagggaaagatttaatcaatttcagtaagaggagg
aaagtagctgaaattactggagaaattcagcagtatcagaatcaaccttactgtttacgg
atagaaccagaaatgaggaggttctttgaaaaccttaaccccatgggaagtgcttctgaa
aaggagtttacggattatttgttcaacaaatcactagaaattgaaccccgaaactgcaaa
cagccacctcgatttcctaggaaatcaactttctctttaaaatctcctggaatacggcct
aatacaggccgacatggctctacctcaggcactttacgaggtcatccaacgccattagaa
agagaaccatgtaaaatgagctttagtcggattgctgaaactgatattgaatcaacggtg
tcagcaccgacctctccaaatacaccatctactccaccagtatctgcttcttcagacctt
agtgtgtttttggatgtggatctcagcagttcctgtggcagcaatagcatctttgctcca
gtcctcttgccacattcaaaatctttcttcagctcctgtggtagtttacataaactgagt
gaagagccgctgatcccccctccgcttcctcctcgaaaaaagtttgaggacgatgcttca
aactccaagggaaatacgaaatctgatgatgacccccctgctattccaccaagacagcct
cctcctccaaaggtaaaacccagagctcctgctcctactggtgcatttgacgggcctctg
cacagtccacctccaccgccaccaagagaccctcttcctgatacccctccaccagttccc
cttcggcctccagagcactttctaaactgcccgtttaatcttcagccacctccactagga
catctgcacagagacccagactggttcagagatgttagtacctgcccaaactcgccaaat
actcctcctagcacaccctctccgagagtaccacgtcgatgctacgtgctcagttctagt
cacaaccaccttgctcatcctcaagctccccctgttccaccgaggcagagttcaagccct
cacctgccaaacctaccaaaactgccaccaaagacttacaaacgggagctttcgcaccct
ccgtcattcagactgcctgtgctagaaaatgcggaaactcctcagtga

DBGET integrated database retrieval system