KEGG   Ailuropoda melanoleuca (giant panda): 100474742Help
Entry
100474742         CDS       T01329                                 

Gene name
PPP3R2
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, beta
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04114  Oocyte meiosis
aml04218  Cellular senescence
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04625  C-type lectin receptor signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04720  Long-term potentiation
aml04724  Glutamatergic synapse
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04924  Renin secretion
aml05010  Alzheimer's disease
aml05014  Amyotrophic lateral sclerosis (ALS)
aml05031  Amphetamine addiction
aml05152  Tuberculosis
aml05163  Human cytomegalovirus infection
aml05166  HTLV-I infection
aml05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100474742 (PPP3R2)
   04310 Wnt signaling pathway
    100474742 (PPP3R2)
   04370 VEGF signaling pathway
    100474742 (PPP3R2)
   04020 Calcium signaling pathway
    100474742 (PPP3R2)
   04022 cGMP - PKG signaling pathway
    100474742 (PPP3R2)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100474742 (PPP3R2)
   04218 Cellular senescence
    100474742 (PPP3R2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100474742 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    100474742 (PPP3R2)
   04660 T cell receptor signaling pathway
    100474742 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    100474742 (PPP3R2)
   04659 Th17 cell differentiation
    100474742 (PPP3R2)
   04662 B cell receptor signaling pathway
    100474742 (PPP3R2)
  Endocrine system
   04922 Glucagon signaling pathway
    100474742 (PPP3R2)
   04921 Oxytocin signaling pathway
    100474742 (PPP3R2)
   04924 Renin secretion
    100474742 (PPP3R2)
  Nervous system
   04724 Glutamatergic synapse
    100474742 (PPP3R2)
   04720 Long-term potentiation
    100474742 (PPP3R2)
  Development
   04360 Axon guidance
    100474742 (PPP3R2)
   04380 Osteoclast differentiation
    100474742 (PPP3R2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100474742 (PPP3R2)
   05014 Amyotrophic lateral sclerosis (ALS)
    100474742 (PPP3R2)
  Substance dependence
   05031 Amphetamine addiction
    100474742 (PPP3R2)
  Infectious diseases
   05152 Tuberculosis
    100474742 (PPP3R2)
   05166 HTLV-I infection
    100474742 (PPP3R2)
   05163 Human cytomegalovirus infection
    100474742 (PPP3R2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100474742 (PPP3R2)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100474742 (PPP3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Motif
Other DBs
NCBI-GeneID: 100474742
NCBI-ProteinID: XP_002926512
Position
Un
AA seq 170 aa AA seqDB search
MGNEASYPEEMCSHFNSDEIKRLGKRFKKLDLDSSGALSMEEFMSLPELQQNPLVQRVVD
VFDTDGNGEVDFKEFILGTSQFSVRGDEEQKLRFAFSIYDIDKDGYISNGELFQVLKLMV
GNNLKDWQLQQLVDKTIIILDRDGDGKISFEEFCAVVGGLEIHKKLVVVV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaagccagttacccggaggagatgtgctcccacttcaactctgatgaaatc
aaaaggctgggcaagaggtttaagaagctggacttggactcttcgggcgcgctgagcatg
gaggagttcatgtccctgcccgagctgcagcagaacccattggtgcagcgagtggtcgac
gtcttcgacaccgatggcaacggagaagtggacttcaaggagttcatcctggggacctcc
cagttcagtgtcaggggggacgaggagcaaaagttgaggtttgccttcagcatctacgac
attgataaagacggctacatttccaacggggagctcttccaggtgctgaagctgatggtg
ggcaacaacctgaaggactggcagctgcagcagctcgtggacaaaaccatcatcatcctg
gatcgggatggagacggcaaaatatccttcgaggaattctgtgctgtggttggaggcctg
gagatccacaagaagttggtggtggtagtgtga

DBGET integrated database retrieval system