KEGG   Ailuropoda melanoleuca (giant panda): 100474802Help
Entry
100474802         CDS       T01329                                 

Gene name
MAP4K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100474802 (MAP4K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100474802 (MAP4K4)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100474802 (MAP4K4)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: STE group
  STE20 family
   100474802 (MAP4K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like Kdo Activator_LAG-3 FTA2
Motif
Other DBs
NCBI-GeneID: 100474802
NCBI-ProteinID: XP_011223234
Position
Un
AA seq 424 aa AA seqDB search
MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEVGKGKCPVA
FLFL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactcccctgcaaaaagtctggtggacatcgacctctcttcactgcgggat
cctgctgggatttttgagctggtggaagtggttggaaatggcacctatggacaagtctat
aagggtcgacatgttaaaacaggtcagctggcggccatcaaagttatggatgtcactgag
gatgaagaggaagaaatcaaactggagataaatatgctgaagaaatattctcatcataga
aatattgcaacatattacggtgctttcattaaaaagagccctccaggacatgatgaccaa
ctctggcttgttatggagttctgtggggctgggtccattacagaccttgtgaagaacacc
aaagggaacacactcaaggaagattggatagcttacatctccagagaaatcctgaggggc
ctggcacatcttcacatccatcacgtgattcacagggacatcaagggccagaatgtattg
ctgaccgagaatgcagaggtgaaacttgtcgattttggtgtgagtgctcagctcgaccgg
acggttgggaggagaaacaccttcataggcaccccctactggatggctcctgaggttatc
gcttgtgatgagaacccagatgccacctacgattacagaagtgacctttggtcttgtggc
attacagccattgagatggcagaaggtgctccccctctctgtgacatgcatccaatgaga
gcactgtttctcattcccagaaaccctcctcccaggctgaagtcaaaaaaatggtcaaag
aaattttttagttttatagaagggtgcctggtgaagaattacatgcagcgaccctccaca
gagcagcttttgaaacacccttttataagggatcagccaaacgaaaggcaagttagaatc
cagcttaaggaccatatagaccggaccagaaagaagagaggagagaaagatgaaaccgaa
tatgagtacagtgggagtgaggaagaagaggaggaagtgcctgaacaggaaggagagcca
agctccatcgtcaacgtgcctggtgagtcgacgcttcgtcgggatttcttgagactgcag
caggagaacaaggaacgttctgaggctcttcggagacagcagttactgcaggagcaacag
ctccgggaacaagaagaatataaaaggcagctgctggcagagaggcagaaacggattgag
caacagaaagaacagaggcggcggctagaagaggtaggaaaagggaaatgtccagttgct
tttctttttctttag

DBGET integrated database retrieval system