KEGG   Ailuropoda melanoleuca (giant panda): 100475315
Entry
100475315         CDS       T01329                                 

Gene name
ACER2
Definition
(RefSeq) alkaline ceramidase 2
  KO
K01441  alkaline ceramidase [EC:3.5.1.23]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00600  Sphingolipid metabolism
aml01100  Metabolic pathways
aml04071  Sphingolipid signaling pathway
Module
aml_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100475315 (ACER2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100475315 (ACER2)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     100475315 (ACER2)
SSDB
Motif
Pfam: Ceramidase
Other DBs
NCBI-GeneID: 100475315
NCBI-ProteinID: XP_002918571
Ensembl: ENSAMEG00000002944
UniProt: D2H9N1
Position
7
AA seq 275 aa
MSIPHWWDQLRAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFVLPPICMCLFRQYAACF
NSGIYLIWTLLVVVGIGSVYFHATLSFLGQMLDELAILWVLMCALAMWFPRRYLPKVFRN
DRGRFKAVVCVLSAVTTCLAFVKPAINNISLMTLGVPCTVLLIAELRRCDNVRVFKLGLF
SGLWWTLALFCWISDRAFCELLSSFHFPYLHCVWHILICLAAYLGCVCFAYFDAASEIPE
QGPVIKFWPSEKWAFIGVPYVSLLCASKKSPVKIT
NT seq 828 nt   +upstreamnt  +downstreamnt
atgagcatcccgcactggtgggaccagctgcgggctggcagctcggaggtggattggtgc
gaggacaactacaccatcgtgcctgccatcgccgagttctacaacacgatcagcaacgtg
ttatttttcgtcttgccgcccatctgcatgtgcttgtttcgccagtacgcagcgtgcttc
aacagcggtatctacctcatatggacgctcttagttgtagtgggaattggatccgtctac
ttccatgcaaccctaagtttcttgggtcagatgctcgatgaacttgcgattctttgggtt
ctgatgtgtgctctggccatgtggttccccagaaggtatctaccaaaggtctttcggaat
gacaggggcaggttcaaggcggtggtctgcgtcctttctgccgttacgacatgcctggcg
tttgtcaagcccgccatcaacaacatctctctgatgaccctcggggttccttgcaccgtg
ctgctcattgcagagctaaggaggtgtgacaacgtgcgtgtctttaagctgggcctcttc
tcgggcctctggtggaccctggcgctcttctgctggatcagtgaccgagccttctgtgag
ctgctgtcgtctttccactttccctacctgcactgcgtgtggcacatcctcatctgcctt
gctgcctacctgggctgcgtatgctttgcctactttgatgctgcctccgagatccctgag
cagggccccgtcatcaagttctggcccagcgagaaatgggccttcatcggcgtcccctac
gtgtccctcctgtgtgccagcaagaagtcgcccgtcaagatcacgtga

DBGET integrated database retrieval system