KEGG   Ailuropoda melanoleuca (giant panda): 100475673Help
Entry
100475673         CDS       T01329                                 

Gene name
GPX8
Definition
(RefSeq) glutathione peroxidase 8 (putative)
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00480  Glutathione metabolism
aml00590  Arachidonic acid metabolism
aml01100  Metabolic pathways
aml04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100475673 (GPX8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100475673 (GPX8)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    100475673 (GPX8)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100475673 (GPX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 100475673
NCBI-ProteinID: XP_002928837
Ensembl: ENSAMEG00000009459
UniProt: D2I0X9
Position
Un
AA seq 209 aa AA seqDB search
MEPLTAYPLRCSGSKAKVFAVLLSMVLCTVMLFLLQLKFLKPKINSFYTFEVKDVKGRTV
SLEKFKGKVALVVNVASDCQLTDRNYLALQELHKEFGPFHFSVLAFPCNQFGESEPRPSK
EVVSFARNNYGVTFPIFHKIKILGSEADPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKS
WRPEEPIEVIRPEIAALIRQMIIRKKEDL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcttacagcgtaccctttaagatgttcagggtcaaaagcaaaggtatttgca
gttttactatctatggttctatgcacagtaatgctatttcttctacaactaaaattccta
aaacctaaaatcaacagcttttatacctttgaagtgaaagatgtgaaaggaagaacggtt
tctctggaaaagtttaaaggcaaagttgcactagttgtaaacgtggctagtgactgccaa
ctcacagacagaaattacttagcactgcaggaactgcacaaagagtttggaccattccac
ttcagcgtcttggcctttccatgcaatcagttcggagaatcggagccccgcccaagcaag
gaagtagtatcttttgcaagaaataactacggggtgacgttccccatcttccacaagatt
aagattctaggatctgaagcagaccctgcgtttagatttcttgttgattcttcaaagaag
gaaccaaggtggaatttttggaagtatctggtcaaccctgagggccaagttgtgaagtcc
tggaggccagaggaacccattgaagtcatcaggcctgagatagcagctctgattagacaa
atgatcataagaaagaaagaggacctgtga

DBGET integrated database retrieval system