KEGG   Ailuropoda melanoleuca (giant panda): 100476030
Entry
100476030         CDS       T01329                                 

Gene name
ID3
Definition
(RefSeq) DNA-binding protein inhibitor ID-3
  KO
K17694  DNA-binding protein inhibitor ID3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04350  TGF-beta signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100476030 (ID3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100476030 (ID3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100476030 (ID3)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    100476030 (ID3)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 100476030
NCBI-ProteinID: XP_002913316
Ensembl: ENSAMEG00000009673
UniProt: D2GWC3
Position
2
AA seq 119 aa
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH
NT seq 360 nt   +upstreamnt  +downstreamnt
atgaaggcgctaagcccggtgcgcgggtgctacgaggcggtgtgctgcctgtcggaacgc
agcttggccatcgcgcgcggtcgcggcaagggtccagcagccgaggagccgctgagcctg
ttagacgacatgaaccactgctactcgcgcttgcgggaactggtccccggagtcccgcga
ggcactcagcttagccaggtggaaatcctgcagcgcgtcatcgactatatcctcgacctg
caggtggttctggccgagcccgcccctggacccccagacggcccgcatcttcccatccag
acagccgagctcgctcccgaactcgtgatttccaacgacaagagaagcttctgccactga

DBGET integrated database retrieval system