KEGG   Ailuropoda melanoleuca (giant panda): 100476142Help
Entry
100476142         CDS       T01329                                 

Gene name
MARS2
Definition
(RefSeq) methionyl-tRNA synthetase 2, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00450  Selenocompound metabolism
aml00970  Aminoacyl-tRNA biosynthesis
aml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100476142 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100476142 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aml01007]
    100476142 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aml03016]
    100476142 (MARS2)
Enzymes [BR:aml01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     100476142 (MARS2)
Amino acid related enzymes [BR:aml01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   100476142 (MARS2)
Transfer RNA biogenesis [BR:aml03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100476142 (MARS2)
 Prokaryotic type
   Other AARSs
    100476142 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 DUF5600
Motif
Other DBs
NCBI-GeneID: 100476142
NCBI-ProteinID: XP_002920066
Ensembl: ENSAMEG00000019748
UniProt: D2HDH9
Position
Un
AA seq 593 aa AA seqDB search
MLRISVLRLLGRPGTSGVSLLEYISSRYYSSGPLGARDDARDARAVFTTPIFYVNAAPHI
GHLYSALLADALCRHRRLRVPSAAATRFSTGTDEHGLKIQQAAASAGLAPTELCDRVSAQ
FQQLFREAGISSTDFIRTTEARHRIAVQHFWGLLKARGLLYKGLYEGWYCASEECFLPEA
KVTRQSDSSGDSCYVSLESGHPVSWTKEENYIFRLSQFREPLQRWLRGDPQAITPEPFLR
AVLQWLEEELPDLSVSRKSSHLHWGIPVPGDDSQTIYVWLDALVNYLTVIGYPNAEFKSW
WPTTSHIIGKDILKFHAIYWPALLLGAGMSPPHRIYVHSHWTVCGQKMSKSLGNVVDPRT
CLDRYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLDSELADALGGLLNRCTAKRINPSGT
YPVFCTTCFPSEPGLVGPSVRAQAEDYALVNAVATLPRQVADHYDNFQIYKALEAVSSCV
RQTNSFVQRHAPWRLNWESPVDAPWLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLG
VSATERGLGELCFLPRFYGHPCPFEGRRLGPETGLLFPRLDQSRAWLVKAHRT
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaatttctgtcctgcggctgctaggacgtccgggaaccagtggagtctcgctt
ctggagtacattagctcgcgctactacagttcgggccctctcggcgcccgcgacgatgct
cgcgacgctcgcgccgtcttcacgacacccattttctacgtgaacgcggcgccgcacatt
ggacacctgtactcggcgctactggcggacgccctgtgccgccaccgtcgcctccgagta
cccagcgctgcggccacgcgcttctccactggtacagacgagcatggcctgaagattcag
caagcagcagcctctgcgggcctggcccccaccgagctgtgcgaccgagtgtctgcccag
ttccagcagctttttcgggaggctggcatctcctccaccgattttatccgcaccaccgaa
gcccggcaccggatcgctgtgcagcatttctggggactgctgaaggcccggggtctgctc
tacaagggactctatgaaggttggtattgcgcctccgaagagtgcttcctgcctgaggcc
aaggtcacccggcagtcggattcatcaggggattcgtgttatgtatctctagagagtggg
catcccgtatcctggaccaaggaagaaaactacattttcaggctttctcagttccgagag
ccgcttcagcggtggctgcggggcgacccccaggcaatcactcccgagccatttcttcgc
gcggttcttcagtggctggaggaggagctgccggacctgtctgtctctcgaaagagcagt
cacttacattggggcattcctgtgcccggggacgattctcagaccatctacgtatggcta
gatgccttggtcaactaccttactgtaattggctacccaaatgctgagtttaaatcttgg
tggccaaccacctctcatatcataggcaaggacattcttaaattccatgctatctattgg
cctgccctcctcttgggggccggcatgagcccaccacaccgcatctatgttcactctcac
tggacggtctgtggccaaaagatgtccaaaagcttgggtaacgtggtggatcccaggact
tgccttgatcgctatactgtggatggcttccgatactttcttctccggcagggcgtcccc
aactgggattgtgattactatgatgaaaaggtggttaagttgctagattctgagctggca
gatgctttgggaggtctcctgaaccggtgcactgccaaaagaataaatccttctgggacc
tatccggttttctgcactacctgctttcccagtgagccagggttggtgggaccatcagtt
cgtgctcaggcagaggactatgctttggtgaacgcagtggccactttgcccaggcaggta
gctgaccactatgataactttcagatctacaaggctctggaggcagtgtccagctgtgtc
cggcaaactaatagctttgtccaaaggcatgcaccatggaggttgaactgggagagccca
gtggatgccccctggctgggcactgtacttcatgtggccttggaatgtttgcgagtcttt
ggaactttgctccagcctgtcaccccaagcctagccgataagctgttatccaggttgggg
gtctctgctactgagaggggccttggagagctctgtttcttgcctcgattctatggacat
ccatgtccttttgaagggaggaggctgggacctgaaactgggctcttgtttccaagacta
gaccagtccagggcctggctagtaaaagcccataggacctag

DBGET integrated database retrieval system