KEGG   Ailuropoda melanoleuca (giant panda): 100476243Help
Entry
100476243         CDS       T01329                                 

Gene name
BCKDK
Definition
(RefSeq) branched chain ketoacid dehydrogenase kinase
  KO
K00905  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     100476243 (BCKDK)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   100476243 (BCKDK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 100476243
NCBI-ProteinID: XP_002924799
Ensembl: ENSAMEG00000007253
UniProt: D2HQM5
Position
Un
AA seq 412 aa AA seqDB search
MILASVLGSGPRSGPPLRPLLGPALSLRARSTSATDTHHVEMARERSKTVTSFYNQSAID
VAAEKPSVRLTPTMMLYSGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRSLPFIIGCNP
TILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHI
EDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARR
LCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNAMRATMESHLDTPYNVPDVVI
TIANNDIDLVIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRISPLFGHLDMHSGGQS
GPMHGFGFGLPTSRAYAEYLGGSLRLQSLQGIGTDVYLRLRHIDGREESFRI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatactggcgtccgtgctggggagtggtccccggagcggacctccactccggccctta
ctggggcctgcactctccctccgggcccgctccacatcagccaccgatacgcaccacgtg
gagatggcgcgggagcgctccaagactgtcacctccttttacaaccagtcggccatcgat
gtggcagcggagaagccctcagtccgcctcactccgaccatgatgctctattcaggccgc
tctcaggatggcagccaccttctgaaaagtgctcggtacttgcagcaagagttgccagtg
aggatcgctcaccgcatcaagggcttccgtagccttcctttcatcattggctgcaacccc
accatactgcacgtgcacgagttgtacatccgtgccttccagaagctgacagacttccct
ccgatcaaggaccaggcggacgaggcccagtactgccagctggtgcgacagctgctggac
gaccacaaggatgtggtgaccctcttagctgagggccttcgcgagagccggaagcacata
gaggatgagaagctcgtccgctacttcttggacaagacactgacttcgaggcttgggatc
cgcatgttggccacacatcatctggcgctgcatgaggacaagcctgactttgttggcatc
atctgcactcgcttgtcgccaaagaagattattgagaagtgggtggactttgccagacgc
ctatgtgagcacaagtatggcaatgccccccgcgtccgcatcaatggacatgtagccgcc
cgtttccccttcatccctatgccgctggactacatcctgcctgagcttctcaagaatgcc
atgagagccacgatggagagtcacttagacacgccctacaacgtcccagatgtggtcatc
accattgccaacaatgatatcgatctcgtcatcaggatttcagaccggggcggggggatc
gctcacaaagacctggaccgggtcatggattaccacttcactaccgccgaggccagcacc
caggacccccggatcagccccctttttggccacctggacatgcacagcggtggccagtca
gggcccatgcacggctttggcttcgggctgcccacctcacgggcctacgcagaatacctc
ggtggttcccttcggctgcagtccctgcagggcattggcacagatgtctacttgcggctc
cggcacatcgatggtcgagaggaaagcttccgcatctga

DBGET integrated database retrieval system