KEGG   Ailuropoda melanoleuca (giant panda): 100476638Help
Entry
100476638         CDS       T01329                                 

Gene name
TTN
Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05410  Hypertrophic cardiomyopathy (HCM)
aml05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100476638 (TTN)
   05414 Dilated cardiomyopathy (DCM)
    100476638 (TTN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100476638 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100476638 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aml04812]
    100476638 (TTN)
   04147 Exosome [BR:aml04147]
    100476638 (TTN)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100476638 (TTN)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100476638 (TTN)
Membrane trafficking [BR:aml04131]
 Others
  Actin-binding proteins
   Others
    100476638 (TTN)
Cytoskeleton proteins [BR:aml04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     100476638 (TTN)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100476638 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Ig_6 Pkinase C1-set fn3_4 Titin_Z PPAK Pkinase_Tyr SusE Adeno_E3_CR1 Izumo-Ig Ig_4 THB Kelch_1
Motif
Other DBs
NCBI-GeneID: 100476638
NCBI-ProteinID: XP_019654795
Ensembl: ENSAMEG00000000394
Position
Un
AA seq 33819 aa AA seqDB search
MTTQAPTFQQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQAISTSTLPGVQISFSD
GRAKLTIPAVTKANSGRYSLRATNGSGQATSTAELLVTAETAPPNFVQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEVVPAKKTKTIVSTAQISETRQTRIEKKIEAHFDARSIATVEMV
IDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT
PSPVRSVSPAGRISTSPIRSIKSPLLTRKTPTPGMAPGPEVPPPWRQEGYVASSEAEMRE
TTVTSATQIRTEERWEGRYGIQEQVTISGGAGAATSVSASAAFAAGAVAAGAAEARQETD
KSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAMHVQPAEEQIKKEAEKKTAVTKVV
MAADKAKEQELKSRTREVITTKQEQVHVTHEQIRKETEKAFVPKVIISATKAKEQETRVT
GQITTKQEQKQVTQETITKETRKTVVPKVIVATPKVKEQDLVSRTREGITTKREQVQITQ
EKMKKEAEKTALSTIAVATAQVAQEQETILRTREGMATRQEQIQVTHGKVDVGKKAEAVA
TVVAAVDQARIREPREPRHLEESYTQQTTMEYGYKEHISATKVAEQPPRPASEPHVVPKA
VKPRVIQAPSETHITTTDQMGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISV
PKTEHGYEASIAGSAIATLQKELSATSSAQKITKSVKAPTVKPAEARVRAEPTPSPQFPF
ADTPDTYKSQAGVEVKKEVSITGDTVREERFKVLHERETKVTETARVPAPVEIPVTPPTL
VSGLKNVTVIEGESVTLECHISGYPSPKVTWYREDYQIESSIDFQITFQSGIARLMIREA
FAEDSGQFTCSAVNEAGTVSTSCYLAVQASEEFEKETTVTEKLTTEEKRFVESRDVVMTD
TSITEEQAGPGEPAAPFFITKPVVQKLVEGGSIVFECQVGGNPKPHVYWKKSGVPLTTGY
RYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEAEYESLMKSQQE
MLYQTQMTAFVQEPKVGEIAPGFLYSDYEKEYEKEQALIRKKMAKDTVMVRTFVEEQEFH
ISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDVSESEAIEAGFDLRIKNYRILEGM
GVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFA
SNMKGNAICSGKLYVEPAAPLAAPTYIPTPEPVSRIRSISPRSVSRSPIRMSPARMSPAR
MSPARMSPGRRLEETDESQLERLYKPVFVLKPASFKCLEGQTARFDLKVVGRPMPETFWF
HDGQQIVNDYTHKVVIKEDGTQSLIIVPAAPSDSGEWTVVAQNRAGKSSISVILTVEAVE
HQVKPMFIEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKG
EAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKE
IAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGD
PTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSAT
LIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEPVR
VLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVK
VTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPKPEFHIHEPGKLQFEVQKVDRPVDTT
EAKEVVKLKRAERITHEKVSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELL
RKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQ
GSDAHFRVRVVGRPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMV
KAINIAGETSSHAFLLVQAKQSIIFTQDLQDVVAKEKDTMATFECETSEPFVKVKWYKDG
VEVHTGDKYRMHSDRKVHFLSVLTIDTSDAEDYSCVLVEDENVRTTAKLIVEGAVVEFVK
ELQDIEVPESFSGELECVISPENIEGKWYHNGVELKSNGKYTITSRRGRQNLTVKDVTKE
DQGEYSFVVDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWMKD
GQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPSLGLSTSGRVSVYSVDVITPL
KDVNVLEGTKAVLECKVSVADVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASD
EGPYKLMVGKVETSCDLSVEKIKIIRGLRDLTCTETQNVVLEVELSHSGIDVLWNFKDKE
IKPSSKYKIEAHGKIYKLTVLNMMKDDEGEYTFFAGENMTSGKLTVAGGAISKPLSDQTV
AESQEAVFQCEVANPDSEGEWLKDGKHLPLSNNVRSESDGHKRRLIIAATKLDDIGEYTY
KVATSKTSARLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLRSSD
KYDISVKGTVYTLRIKNCAVVDESVYGFKLGKLGASARLHVETVKIIKKPKDVTALENST
VAFEVSVSHDTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQHISPSDAGEYTAVVGQL
ECKAKLFVETLHITKTMKNIEVPETKSASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVV
QGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLKVTPIMITSMLKDINAEEKDTITFEVT
VNYEGISYKWLKNGVEIKSTDRCQMRTKKLTHSLNIRNVHFGDAAEYTFVAGKATSTATL
YVEARHIEFRKHIKDIKVLEKKRATFECEVSEPDITVQWMKDGQELPTVDRIKIQKEKYV
HRLLIPSTRMSDAGQYAVVAGGNISTANLYVEGRDVRIRSLKREVQVIEKQRAVVEFEVN
EDDVDAHWYKDGIEINFQIQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSVTL
YVNAPEPPQILQELQPITVQSGKPARFCAVIAGRPQPKISWYKEEQLLSTGFKCKFLHDG
QEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAVITPL
QDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDE
GLYTFVANNAVGQVSSTANLRLAAPESILHGRIEEQIEVQMKAAPVIKRRIEPLEVALGH
LAKFTCEVQTAPNVRFQWFKAGREIYESDKCSIRSSKYVSTLEILRTQVVDCGEYTCKAS
NEYGSVSVTATLTVTEAYPPSFYSRPKSVTTFVGKTAKFLCTVLGTPVIETIWQKDGAAL
SPSPNRKISEAENKHSLELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELE
SVQSAINKKIHLECQVDEDRKVTVTWNKDGQKLPPGKDYKIYFEDKIASLEIPLAKLKDS
GTYVCTASNEAGSSSSSATVTIREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTW
FKNNKELSESNTIRMSFVNSEAVLDLTDVKVEDSGSYSCEVVNDVGSDSCSAEIVIKEPP
SFIKTLEPADIVRGTNAFLQCEISGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVSLEIF
SFNSADVGEYECVVANEVGKCGCSATHLLKEPPSFVKKVDDFTALAGQTVTLQAAVRGSE
PISVTWFKGQEIIKEDGKIKMSFSNGVAVLIIPDVQISFGDKYTCLAENEAGSQTSVGEL
IVKEPAKIVERAELIQVTAGDPATLEYTVTGTPELKPKWYKDGRPLVASKKYRISFKNNV
AQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVGSVVNSTCR
LDCRVAGSLPMRVSWFKDGREIAASDKYRIAFVEGTASLEISRVDMNDAGNFTCRATNSV
GSKDSSGALIVQEPPSFVTKPASKDVLPGSAVCLKSTFQGSTPFTVKWFKGAKELVSGGS
CYISKEALESSLELYAVKTSDSGTYTCQVSNVAGSVECSANLFVKEPATFVERLEPSQLL
KKGDATQLACKVTGTPPIKITWFANDREIKESSKHKMTFVESTAVLRLTDVAIEDSGEYM
CEAQNEAGSDHCGSILIVKESPYFTKEFKSIEVLKEYDVMLLAEVAGTPPFEITWFKDNT
TLRSGRKYKTFIQDQLVSLQILKFVATDAGEYQCRVTNEVGSSTCSARVTLREPPTFVKK
IESTSSLRGGTAAFQATLKGSLPITVTWLKDNEEITEDDNIRMTFENNVASLYLSGIEVK
HDGKYVCQARNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKELTAR
WFKDGQELTLGQKYKISVTDTVSVLKIISTEKRDSGEYTFEVQNDVGRSSCKASINVLDL
IIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEITASEKYKFSFHDNTAF
LEISHLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVSPHTRVQLKALV
GGTAPMTIKWFKDNKELHSGAARSVWKDDTSTLLELFSAKAADSGTYICQLSNDVGTATS
KATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPEIRVSWYLDGNEITAIKKYGIS
FIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELRPVEVVKDSD
VQLECEVAGTSPFEVTWLRNNKEIRSSKKYTLTDRVSVFNLHITRCDPSDTGEYQCIVSN
EGGSCSSSTRVSLKEPPSFVKKIENITTVLKSSATFQSTVAGSPLISITWLKDDHILDED
DNVHISFVNNVATLQIRAVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQILEKAKSVD
VTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQY
TFKVENDFGSSSCDAHLRVLDQDIPPSFTKKLTKMDKVLGSSIRMECKVSGSLPISAQWF
KDGKEISTSAKYRPVSHENTVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPS
FLVKPERQQAIPDSTVEFKAVLKGTPPFKIKWFKDDVELASGPKCFIGLEGSTSFLNLYS
VDASKTGQYTCQVTNDVGSDSCTTVLLVTEPPKFVKKLEASKIVKAGDSTRLECKITGSP
EIRVVWYRNEHELHTSNKYRMTFIDAVAVLQMNNLSTEDSGDFICEAQNPAGSTSCSTKV
IVKEPPVFSSFPPVVETLKNTEVSLECELSGTPPFDVIWYKDKRQLRSSKKYKIASKNFH
ASIHILNVEASDIGEYYCKAQNEVGSDTCICTVKLKEPPRFVSKLNSLTVVAGEPAELQA
SIEGAQPISVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGM
RENMATLTVLEPAVIVEKAGSMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHK
FSFYNKISSLKILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRMVPPSFTRRLRGTLG
VLGTSCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDTGNYT
CVAANAAGSDECRAVLAVQEPPSFVKEPEPLEILPGKNVTFTSVIRGTPPFKVGWFRGAR
ELMRGDRCNIYFEDTVAELELFNVDISQSGEYTCVVSNNAGQTSCTTHLFVKEPATFVKK
LSDHSVEPGKSIILEGTYTGTLPISVAWKKDGVNVAPSERCSIVTTEKTCILEILSSTKR
DAGQYSCEIENEAGRDVCQALVSTLEPPYFVTELEPLEASAGDSVSLQCQVAGTPEITVS
WYKGDTKLRPTPEYRTYFTNNVATLVFNKVTINDSGEYTCKAENSIGTASSKTVFRIQER
QLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVAT
LKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFE
CHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGK
DMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKY
NMSFVNSVALLTINEGSTEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPAPIGALK
GSDVIFQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHILNLDASDVGEYHCK
ATNEVGSDTCVCTVKFKEPPRFVKKLSDTSTLVGDAVELRAVVEGFQPISVVWLKDKGDV
IRESENTRISFVDNVATLQLGSPEASDSGKYVCQIKNDAGMRECSAVLTVVEPARIVERP
EPMTVTTGNPFALECVVAGTPELSVKWFKDGRELSADSKHQITFINKVASIKIPCAEMSD
KGLYSFEVKNSVGKSTCSVSVHVSDRVVPPSFIRKLKDMNAILGTSAVLECRVSGSAPIS
VGWFQDGNELISGPKCQSSFSENVCTLNLSLLEPSDTGVYTCVAANVAGSDECSAVLTVQ
EPPSFEQIPDSVEVLPGTSLIFTSVFRGTPPFKVKWFKGSRELVSGESCTISLEDFVTEL
ELLEVEPLQSGDYSCLVTNDAGSASCTAHLFVKEPATFVKKLADFNVETGSPIVLEATFT
GTPPISVNWMKNEFLLSQSQNCSITMTEKSTILEITESTIEDYAQYSCLIENEAGQDICE
ALVSVLEPPYFIEPLQHVEAAIGEPTTLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFK
NNVASLVINKVDHSDVGEYTCKAENSVGAVASSGVLVIKERKLPPSFARKLKDVHETLGF
PVAFECRINGSEPLQVSWYKDGVLLKDDANLQMSFVHNVATLQILQTDQSHVGQYNCSAS
NPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPIKITWAKDNRE
IRPGGNYKMTLVENTATLTILKVSKGDAGQYTCYASNVAGKDSCSAHLGVQEPPRFIKKL
ETSRIVKQDEYTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFLDSVAVLEMHNLSVE
DSGDYTCEARNAAGSASSSTSLKVKEPPVFRKKPHPVETLKGADVHLECELQGTPPFQVS
WHKDKRELRSGKKYKIMSENFLTSIHILNVDTADMGEYQCKATNDVGSDTCVGSITLKAP
PRFVKKLSDVSTIVGEEVQLQTAIEGAEPISVVWFKDKGEIVRESDNIWVSYSENIATLQ
FARAETANAGKYTCQIKNDAGMQECFATLSVLEPAAIVEKPESIRVTTGDTCTLECTVTG
TPELSTRWFKDGKELTSDSKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTA
SVQVSDRAVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTT
LTDNTCALTVNMLEESDAGDYTCVATNVAGSDECSAPLTVREPPSFVQKPEAMDVLMGAN
VTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVETTQSGEYTCIVSN
EAGRASCTTHLYVKAPAKFVKRLNDYSIEKGKPLILEGTYTGTPPISVTWKKNGINVTPS
QRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVK
VTVGDSASLQCQIAGTPEIGVSWYKGDTKLRPTSTCKMHFRNNVATLVFNQVDGSDSGEY
ICRAENSVGEVSSSTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFECTIHGSEPISVSWY
KDGKPLKDSPNVQTSFLDNVATLNIFKTDRSLAGQYSCTATNPIGSASSGARLILTEGKN
PPFFDIPVAPVDAVVGDSADFECHVTGTQPIKVAWAKDNREIRSGGNYQISYLENMAHLT
ILKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKKLSETVEETEGNSFRLEG
RVAGSQPITVAWYRNNIELHPTSNCEITFKNNTLLLHVKKAGMGDAGLYTCKVSNDAGSA
LCTSSIVIKEPKKPPVFDQHLTPVTASEGEFVQLSCHVRGSEPIRIQWLKAGREVKPSDR
CSFSFAHGTAVLELKDVAKADSGDYVCKASNVAGSDTSKSKVTIKDKPAAVPAAKKAAVD
GKLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRILIHQKGDEAK
LEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPILKKGA
GEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEEIEK
SEKDEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDDDAVFEIDIKINYPEIKLSWY
KGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIASAKLTVIEPAWERHL
QDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLTIADVRAEDQ
GQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKGPT
ELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTKEIKLE
MKPPDIPDSRVPIPTMPIRAVPPEEIPPMVVPPIPLLLPSPEEKKPPAKRIEVTKKAVKK
DTKKVVAKPKEEPKEVDKKPLPPIALIPAKAPEIVDISSKAEEVKITTITRKKEVHKEQE
AVYEKKRAVYEEKKLFIESLEEPYDELEVEPYTEPYEEPYYEEPDEDYEETKVEAKREVH
EEWEEDFEEGQEYYEREEGYDEGEEDWEETYQEREVVQVQKEVYEESHERKIPAKVPEKK
APPPKVVKKPVVEKIEKTSRRMEEQKVQVTKVPEVSKKIVPQKPSRTPVQEEVIEVKVPA
VHTKKMVISEEKMFFASHAEEEVSVTVPEVQKKTVTEEKIHVAVSKKIEPPPEVPELPKK
PVPEEVVAVPIPKKVEPPPTKVPEVPKKPVPEEKKPVPVPKKEPPAPPKVPEVPKKPVPE
EKIPVPVAKKKEVPPAKVPEVQKKVVTEEKITIVTQREESPPPAVPEIPKKKVPEEKRPV
PQKEEEVPPPKVPRKKPIPEEKVPVPVPVAKKAPPPRAEISKKTVVEEKRFAAEERLSVA
VPQTVELRRHEEEEWSYSEEEERVSVSVYREEEREEEEVEVTEYEVMEEPEEYVVEEKVH
FISKRVEAEPAEVVEKHEKKVVLKPKVPAKIEEPPPAKVPEVPKKPVPEKKVPAAVPKAE
KVPPVPEEPKKPVPEKRVPPKVAKKEEPPPTKVTERHMQITQEEEVHVAVTKKEEPPRAR
VPEEPKRAVPEEKIPKLKPRREEEPPAKVTELRKRAVKEEKISIEVPKREAPPVKEVTVT
EEKAWSYTREEEIVSVEREEEYDEYEEYDYKELEYEPTEEYDQYEEYEEREFEHYEEYKE
HEEYVTEPKKPLPVKPVQEEPVPTKPKAPPTKVLKKPVPEEKVPVPIPKKLKPPPPKVPE
EAKKVVEEKIHISITKREKEQVAEPAVKVPIKPKRVVTEEKVLVPKKEVTAPVRVAEVLK
RQEQEEIVFEEEVVTHVEKYFEEEEEEEKEEEEEEEEEEEYIHEEEELATEEEVVPVIPA
KVPEIPKKPVPEEKKPVPVPKKKEAPPAKVPEIPKKPEEKVPVPIPKKEKPPPAKVPEVP
KKPVPEEKVPVPVPKKVEAPPAKVPEVPKKPVPEKKVLVPVPKKVEAPPAKVPEVPKKII
PEEKPTPVPKKVEAPPPKVPKKREPVPVPVALPREEEVPFEEEIAPEEEVLPEEEEVLPE
EEEVPPEEEEVPPEEEEFIPEEEVEPEEEEVLPEIKPKVPVPARVPEVPKKPVPQKKVPV
PAPKKVEPPPPKVPEVKKKVPEKKVVIPKKEEAPPAPVPVVLKKPEPEKKVPPPGVKKAV
APPAKVPEVPKKVEERRIILPEEEEVPPVEVYEEPEEPIPEEEIPEEPPSIEEVEEVAPP
RVPEVVKKAVPEAPTPVPKKVEAPPAKVPKKVPEEKVPVPVQKKEPPPAKVPEKKVPEKK
IAEKKVPVPKKEAVPPAKGRTVLEEKISVAFHKEEVVRERTELEIVETPVEVLEEEEFHE
VQEYFEEEEFHEVEEFIKVERPRVEDVHRAEEVHRVIEVLETEEVEVYEKPKAPPKGPEI
SEKIIPPKKPPTKVVPRKEPPAKVPEVPKKIVVEEKVRVPEEPEFPPAKAPEVPKKIVPE
EKVREAVPKKPEVPPTKVPEAPKEVVPEKKVAVMPPKKPEVPPVKVPEAPKEVVPEKKVP
VMPPKKPEVPPAKVPEVPKAAVPEKKVPEAVPPKPESPPPAVPEVTPEEVIPEKKVPVAP
PKKPEAPPAKVPEAPEEVVPEKKVSVVVPKTPEAPPAIVPEVAQEVVPEKIIPKAPPKTP
GAPPVTVPEVAQEVVPEPKFPKAPPKKPEARPVSVPEFPQEIVPEKKAPMVPPKKPEVAP
VKVPEAPKEVVPEKKVSVALPKKPEVPPVKVPEAPKEVVPEKKVSVALPKKPEVPPVKVP
EAPKEVVPEKKVSVALPKKPEVPPVKVPEVPQEIVPEKKAPVVPPKKPGVAPVTVPEVPQ
EVVPEKKVSVALPKKPEVPPVKVPEAPKEVVPEKKVPVMPPKKPEVPPAKVPEAPKEVVP
EKKVPVMPPKKPEVPPAKVPEAPKEVVPEKKVAVMPPKKPEVPPVKVPEAPKEVVPEKKV
PVMPPKKPEVPPAKVPEVPKAAVPEKKVPEAVPPKPESPPPAVLEEPEEAAWEEPTVEVV
EEPEPIAPPEVTVPPKKPVPEKKPPAVIAKKPEPPPVKVPEVPKEVVPEKKVPPVVPKKP
EVPPAKVPEVPKEVAPEKKVTVPKKPEVPPPKVPEVPKKPAVEEEPAVPAPKEVEPPAEV
YEEPEEIAAEEEEPVPVAEEEPEAPPPAVPEEPKKIVPEKKVPVIKKTEAPPPKEPEPEP
EKKVIEKPKLKPKPAAPPPAPPKEDVKEKIFQLKAVPKKKVPEKPEVPEKVELKPLKVPG
VEKKVRKLLPEPKPQPKEEVVLKSVLRKRPEEEEPKVEPKKLEKIKKPVPEPPPKAVEEA
EVPPAPVTKRERKVPEPVKVPEIKPAIPLPAPEPKPKPEPEVKIIKPPPVEPPPTPIAAP
VTVPVVGKKAEAKAPKEEAAKPKGPIKGVAKKTPSPIEAERKKLRPGSGGEKPPDEAPFT
YQLKAVPLKFVKEIKDIVLTEAESVGSSAIFECLVSPSTAITSWMKDGSNIRESPKHRFI
ADGKDRKLHIMDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKG
QPLYLSCELNKERDVVWRKDGKIVVEKPGKIVPGVIGLLRALTINDADDQDAGTYTVTVE
NANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAVFSCVIAKDTPNIKWFKGYDEIPL
EPNDKTEIVREGKQLFLKVKNATPEDIDEYAVEIEGKRYPAKLTLGDREVELLKPIEDVT
IYEKESASFDAEISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVL
YQALNAFTTAILTVKEIELDFAVPLKDVTVPERRQARFECVLTREANVIWSKGPDIIKAS
DKFDIIVDGKKHILVINDSQFSDEGVYTAEVAGKKSSARLFVTGIRLKFISPLEDQTVKE
GETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMREVTLDDISQIKAQV
KDLSSTANLKVLEADPYFTVKLHDKTGVEKDEIILKCEVSKDVPVKWFKDGEEIVPSTKY
SIKSDGLRRVLKIKKADLKDKGEYMCDCGTDQTKANLNVEARLIKVEKPLYGVELFVGET
ARFEIELSEPDVHGQWKLKGEPLTASPDCEIIEDGKKHILVLYNCQLDMTGEVSFQAANA
KSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDKVEL
IKDGTKHSLVIKSAAFEDEGKYMFEAEDKHTSAKLIIEGIRLKFLTPLKDVTAKERESAV
FTVHLSHDNIRVKWFKNDQRLHTSRSVWMDDEGKTHSITFRDLTIDDTSQIKVEAMGLSS
EAKLTVLEGDPYFTGKLQDYTGVEKDEVVLQCEISKADAPVKWFKDGKEIEPSKNVVIKA
DGKKRILILKKALKSDIGQYTCDCGTDKTSGKLNIEDREIKLVRPLHSVEVMETETARFE
TEISEEDIHANWKLKGEALLQTPDCEIKEEGKMHFLILHNCRLDQTGGVDFQAANVKSSA
HLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEG
KVHTLTLRDVKLEDAGEVQLRAKDFKTHANLFVKEPPVEFTKPLEDQTVEEEATAVLECE
VSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLIIHGCTPEDIKKYTCDAKDFKTSCNL
NVVPPHVEFLRPLTDLQVKEKEMARFECELSRENAKVQWFKDGAEIKKGKKYDIISKGAV
RILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLGNVEVSETDTIKLVCEVS
KPGAEVVWYKGDEEIIETGRYEILTEGRKRILTIQNAHLEDAGSYNCRLPSSRTDGKVKV
HELAAEFISKPQNLEVLEGEKAEFVCSISKESFEVQWKRDDKTLESGDKYDIIADGKKRI
LVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIIVPLKDTRVKEQQEVVFNCEVNTEG
AKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRNARLDDQANYSVSLTNHRGENVKSAANL
IVEEEDLRIIEPLKDIETMEKKTVTFWCKVNRLNVTLKWTRNGEEVPLDNRVLYRIDKYK
HSLIIKDCGFPDEGEYMVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLS
REKANVKWYRNGREIKEGEKYKFEKDGRTHRLIIKDCRLDDECEYACGVEDRKTRARLFV
EEIPVEIIRPPQDILEAPGTDVVFWAELNKDKVEVQWLRNNMVIVQGDKHQMMSEGKIHR
LQICNIQPRDQGEYRFIAKDKEARAKLELAAAPKIKTDDQDLVVDVGQPLTMVVPYDAYP
KAEAEWFKENEPLSSKTVDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVI
DVPGPVRNLEVTETFDGEVSLGWEEPLTDGGSKIIGYVVERRDVKRKTWVLATDRADSCE
FTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVAITDINRFGV
SLTWEPPEYDGGAVITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRA
QNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLTWEPPLKDGGSPILGYI
IERCEEGKDNWIRCNKKLVPKLTYQVTGLQKGNKYLYRVSAENEAGVSDPSEILGPLTAD
DASVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPRPSATWSFGDKVLEAGDRVKIKTLS
AYAELVISPSERPDKGIYTLKLENRVKAISGEIDVNVIARPSAPKELKFGDITRDSVHLT
WEPPDDDGGSPLTGYVVEKREVSRKTWTKVIDSVTDLEFTVPDLVQGKEYLFKVCARNKC
GPGEPAYVDEPVNMSVPATVPDPPENVKWRDRTANSIFLTWDPPKHDGGSRITGYIVEKC
PRGSDRWVACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGPSKPSKPTDEIQAVDTQEA
PEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMLLKQDKRITIENVPKKST
VTIMDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDVTEVTNESCLLTWNPP
RDDGGSKITNYVVERRATDSEVWHKLSSTVKDTNYKATKLTPNKEYIFRVAAENMYGVGE
PVQASPITAKFQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTD
KWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKTTEPILIKDPIDPPWPP
GKPTVKDVGKTSLMLNWTKPEHDGGAKIESYVIEMLKTGTDDWVRVAEGVPTTQHLLTGL
MEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVP
EKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSD
YCEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYIIEKKEKLG
TRWVKAGKTSGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILAIEDPTSPPSP
PLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVE
EGVVPDKEYVLRVRAVNAVGVSEPSEISENVVAKDPDCKPTIDMETHDIVVIEGEKLSIP
VPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKCVHADAGVYTITLENKLGS
ATGKINVKVIGLPGPCKDIKASDVTKSSCKLTWEPPEYDGGSPILHYVLERREAGRRTYI
PVMSGENKLAWTVKDLIPNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPIDVE
VHNPTAKAMTITWKPPLYDGGSKIMGYIIEKIAKGEDKWKRCNEHLVPVLTYTAKGLEEG
KEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVIMRTSLEVKRGDEIALDATISGSP
YPTITWLKDEKVITPEEIKKRVAPTIRRKRGEVQEEEEPFVLQLTERLSIDNSKKGESQL
RVRDSLRPDHGLYMIKAENDHGIAKAPCTVCVLDTPGPPINFVFEDIRKNSVLCKWEPPL
DDGGSEIINYTLEKKDKTKPDSEWITVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPG
PPCVSKPLIAKDPFEPPDAPDKPIVEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNST
HWTRVNRSLLNSLKTNVEGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTARDPISPPGPP
VPRVTDTSSTTIDLEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKPRQYTVREI
REGADYKLRVSAVNAAGEGPPGETGPVTVAEPQEPPSVELDVSVKAGIQIMAGKTLRIPA
VVTGRPVPTRVWTIEEGELDKDRVVIENVGNKSDLIIKNALRKDHGRYVITATNSCGSKS
AAARVEIFDVPGPVLDLKPVVTNRKMCLLNWSDPADDGGSEITGFIIERKDAKMHTWRQP
IETERSKCDITGLIEGQEYMFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTER
TKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSLLVEDLDEHQMYE
FRVKAVNAVGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVNIPADVTGLP
MPKIEWSKNETVIEKPTDALKITKEEVSRSEAKTELIIPKAVREDKGTYTITASNRLGSV
FRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKSEW
EEVTNSAVERKYGVWKLIPNGQYEFRVRAVNKYGISDDCKSDKVVIQDPFRLPGPPGKPK
VLERTKGSMLVSWTPPLDNGGSPITGYWLEKREEGGAYWSRVSRAPITKVGLKGVEFNVP
RLIEGVKYQFRAMAINAAGVGPPSEPSDPAIAGDPIYPPGPPSCPEVKDKTKSSISLAWK
PPAKDGGSPIKGYIVEMQEEGSTDWKKVNEPDKLLTTCECVVPNLKELRKYRFRVKAVNE
AGESEPSDTTGEIPATDIQEVPEVFIDIGAQDCLVCQAGSQIRIPAVIKGRPTPKSSWEF
DGKAKKAVKDGVHDVPEDAQVETAENSSVIIIPECTRAHSGKYSITAKNKAGQKTAHCRV
KVMDVPGPPKDLKVSDITRGSCRLTWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNCG
STTFVVPDLISEQQYFFRVRAENRFGVGPPAETIQRTTARDPIYPPDPPIKLKIGLVTKN
TVHLSWKPPKNDGGSPVTHYIVECLAWDPTGKKKEAWKQCNKRDVEELEFTVEDLIEGGQ
YEFRVKAVNAAGVSKPSATVGPVTVKDQTCPPSIELKEFMEVEEGTDVNIVAKIKGVPFP
ALTWFKAPPRKPDKKEPVVYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTAS
KEMRLNVLGRPGPPVGPIKFESVSADQMTLSWLPPLDDGGSKITNYVIEKREANRKTWVR
VSSEPKECMYTIPKLLEGHEYVFRIMAQNKFGIGEPLDSEPETARNLFSVPGAPDKPTVS
SVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLI
EGSDYQFRVYAINAAGVGPASLPSDPVTARDPIAPPGPPIPKVTDWTKSSVDLEWSPPLK
DGGSKVTGYIVEYKEEGKEEWEQGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEP
GEVTDVIEMKDRIVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPSPTVTWNMNERALP
QEATIETTAISSSMVIKNCQRSHQGVYSLLAKNAGGERKKTIIVDVLDVPGPVGTPFQAH
NLTNDSCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAY
FFRIAAENSVGIGPFTETPTALVIRDPITVPERPEDLEVKEVTKDSVTLTWNPPKYDGGS
EIINYVVESRLIGTEKFHKVTKDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCT
KPITCKDDLAPPTLDLDFRDKLTVRVGEAFALTGRYSGKPKPKITWFKDEADVLEDDRTH
IKTTPTTLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVIFDEVTK
DYMVISWKPPLDDGGSEITNYIIEKKEVGKDIWMPVTSASAKTTCKVPKLLEGKDYIFRI
YAENLYGISDPLVSDSMKAKDRFRVPDAPEQPIVTEVTKDSALVTWNKPNDGGKPITNYI
LEKRETMSKRWARVTKEPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFA
KDPIAKPSPPINPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWKRANHTP
ESCPETKYKVTGLRDGQTYKFRVRAVNEAGESDPAHVPEPVLVKDRLEPPELILDANMAR
EQHIKVGDTLRLSAVIKGVPFPKVTWKKGDREAPTKARIDVTPVGSKLEIPNAAHEDGGI
YSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVV
ERRDVASAQWSPLSATSKKKSHMAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDP
LHPPGPPKNLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTEDWIKFKTVTNLE
CVVTGLQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGT
TVRFPAIIRGVPIPTAKWTTDGSEIKTDEHYTVETDSFSSVLTIKNCLRKDTGEYQITVS
NAAGTKTVAVHLTVLDVPGPPTGPINILDVTPEYMTISWQPPKDDGGSPVINYIVEKQDT
RKGTWGVVSSGSSKTKLKIPHLQKGCEYIFRVRAENKMGVGPPLDSVPTVAKHKFSPPSP
PGKPVVTDITENAATVSWTLPKSDGGSPIIGYYVERREVTGKWVRVNKTPIPDLKFRVTG
LYEGNTYEFRVFAENLAGLSNPSPSSDPIKACRPIKPPGPPINPKLKDKTKETADLVWTK
PLSDGGSPILGYVVECQKPGTTQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVG
EGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVRGRPDPDITWSKEG
KVLVREKRVDIIQDLPRVELQIKEAVRADHGKYIISAKNTSGHAQGSAIVNVLDRPGPCQ
NLRVSNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDATKRLIKANLLA
NNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDY
DGGSPNLSYHVERRLKGSDEWERVHKGSIKETQYMVDRCVENQIYEFRVQTKNEGGESDW
VKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVLWTKDKDATDLTR
SPRVKIDTSADSSKFSLSKAKRSDGGKYVITATNTAGSFVAYATVNVLDKPGPVRNLKIV
DVSSDRCTIHWDPPEDDGGCEIQNYILEKCESKRMVWSTYSANVLTPGATVTRLIEGNEY
IFRVRAENKIGTGPPTESKPVIAKTKYDRPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKS
ITGYFLEKKEKHSVRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAENEIGVGEPSLPSR
PVVAKDPIEPPGPPTNLKVVDTTKSSITLGWGKPVYDGGAPIIGYVVEMRPKREDASPDE
GWKRCNAAAQLVRMEFTVTSLDENQEYEFRVCAQNQAGIGRPAELKDAIKPKEILEPPEI
DLDASMRKLVTVRAGCPIRLFAIVRGRPAPKVTWRRVGIDNVVRKGQVDLVDTMAFLVIP
NSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVTDLKVSDVTKTSCHISWAPPENDG
GSQVTHYIVEKREAERKTWSTVTPEVKKTSFQVTSLVPGNEYFFRVTAVNEYGPGVPADV
PKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYIISYREEEQPADR
WTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPE
QITIKAGKKLRVEAHVYGKPHPVCKWKKGEDDVVTSSHLAVHKADTSSILIIKDVTRKDS
GYYSLTAENSSGTDTQKIKVIVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSNITN
YIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMLAK
FPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPVTGYLIERKERNSLLWVKANDTPV
RSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVSKSTV
SLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTSPHQIPQEEYTVTGLEENAQYQFRA
IAKTAVNISPPSEPSDPVTIQAENVPPRIELSVAMKSLLTVKAGTNVCLDATVFGKPMPT
VSWKKEGTLLKPAEGIKMAMKRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVL
DKPGPPASVKINKMYADRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITS
CTVEKLIEGHEYQFRICAENKYGVGDPIFTEPAIAKNPFDPPGRCDPPVISNITKDHMTV
SWKPPADDGGSPITGYLVEKRETQAVNWTKVNRKPVIERTIKATGLQEGTEYEFRVTAIN
KAGPGKPSDASKAAYARDPLYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVE
VKRADSDNWVRCNLPEKLQKTRFEVTGLMEDTEYQFRVYAVNKIGYSDPSDVPDKHRPKD
ILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRERIGLDIKSTD
FDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYIT
WDPPIIDGGSPIINYVVEKRDAERKSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEY
GIGDPGETRDAVKASETPGPVVDLKVLSVTKSSCSIGWKKPRSDGGSRITGYVVDFLTED
NKWQRVMKSLSLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIIAVAKDDIVAPDLDLKD
IPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLPTDTRVSVESTAVNTTLVVHDCQ
KSDAGKYTITLKNVAGTKEGTLSIKVVGKPGIPTGPIKFEEVTAEAVTLKWGPPKDDGGS
EITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEP
IVAKHPFDVPDAPPPPNIVDVRHDSVSLTWTDPRRTGGSPITGYHIEFKERNSLLWKRAN
KTPIRMKDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINVT
RNSVTLVWTEPKYDGGHKLTGYIVEMRDLPSKTWTKANHVNVPDCAFTVTDLVEGGKYEF
RVRAKNTAGAISAPSESTGTIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLSAISILGK
PLPKSSWSRAGKDIRPSDIVQISSTPTSSMLTVKYATRKDAGEYTITATNPFGTKEEHVK
VTVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKSYVLEKRETSRLLWTVVAEDI
QTCRHVATKLIQGNEYLFRVSAVNQYGKGEPVQSEPVKMVDRFGPPGPPGKPEVSNVTKN
TATVSWKRPVDDGGSEITGYHIERREKKSLRWVRATKTPVSDLRCKVTGLQEGNTYEFRV
SAENKAGIGPPSDASNPVLMKDVAYPPGPPSNARVTDTTKKSASLGWGKPHYDGGLEITG
YIVEHQKVGDEAWIKDTTGTGVRITQFVVPDLQTKEKYNFRIRAINDAGIGEPAIIPDVE
IIEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDDINLKNRANIENT
ESFTLLIIPECNRYDTGKFVMTIENPVGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTL
HWDLPLIDGGSRITNYIVEKREATRKSYSTVTTKCHKCTYKVTGLSEGCEYFFRVMAENE
YGIGEPAETTEPVKASEAPSPPDSLNIMDITRSTVSLAWPKPKHDGGSKITGYVIEAQRK
GSDQWTHVTTVKGLECVVKNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELD
LRGIYQKLVIARAGENIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFENTATSTILNIN
ECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPEND
GGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGVEYQFRVKAQNRYGVGPGIT
SASIVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLTDGGSPILGYHVERKERNGILWQ
TVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPIPL
NITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAA
YEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPRIMVDVKFKDTVILKAGEAFKLEADVS
GRPPPTMEWTKDGKELEGTAKLEIRIADFSTYLINKDSSRRDSGAYILTATNPGGFAKHI
FNVKVLDRPGPPEGPLAVSEVTSEKCVLSWLPPLDDGGAKIDYYIVQKRETSRLAWTNVA
SEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTAI
TKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNKKTLTDLRYKVSGLTEGHEYE
FRIMAENAAGISAPSSTSPFYKACDAVFKPGPPGNPRVLDSSRSSISIAWNKPIYDGGSE
ITGYIVEIALPEEDEWQIVTPPAGLKATSYTITNLIENQEYKIRIYAMNSEGMGEPALVP
GTPKAEERMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWTREHGESLDKAS
IESTSSYTLLIVGNVNRFDSGKYILTIENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKS
SVTLTWEPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVL
AENEYGIGLPAETAESVKASERPLPPGKITLVDVTRNSVSLSWEKPEHDGGSRILGYIVE
MQSKGSDKWATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVI
PPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDDVPLKQTTRVNAESTENSTLLT
IKEACREDVGHYTVKLTNSAGEATETLNIIVLDKPGPPTGPVKMEEVTADSITLSWGPPK
YDGGSSINNYIVEKRDTSTTTWHIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTY
LNSEPVIAQYPFKVPGPPGTPFVMLSSKDSMEVHWNEPVSDGGSKVIGYHLERKERNSIL
WVKLNKTPIPQTKFKTTGLDEGIEYEFRVTAENIVGIGKPSKVSECYMARDPCDPPGRPE
AIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNVIDTQFEVTGLVED
HRYEFRVIARNAAGVFSEPSESTGAITARDEVEPPRISMDPKYKDTIVVHAGESFKIDAD
VHGKPIPTIQWVKGDQELSNTARLEIKSTDFATSLSVKEAVRIDSGNYILKAKNVAGERS
VTINVKVLDRPGPPEGPVLVSGVTAEKCTVAWKPPLQDGGSDIINYIVERRETSRLVWTL
VDANVQTLSCKVTKLLEGNEYIFRIMAVNKYGVGEPLESEPVIAKNPFVVPDAPKAPEIT
TVTKDSMIVVWERPESDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLLENHN
YEFRVSAENAAGLSEPSLPSGYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGG
CEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAVNKAGVGEHAD
VPGPVIVEEKLEAPDIELDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKMDGEIREA
AIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEIT
KDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIEQLQEGCSYYFR
VTAENEYGLGLPAHTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYI
VEMQAKHSEKWSECARVKSLEAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDL
VIEPDVRPAFNNYSVQVGQDLKIEVPISGRPKPTVTWTKDGLPLKQTTRVNVTDSLDLTV
LSIKETHKDDGGHYGITVANVVGQKTASIEIITLDKPDPPKGPVKFDEVSAESITLSWNP
PLYTGGCQITNYIVQKRDTTTTVWDTVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQS
FALESDPIVAQYPYKEPGPPGTPFVTAISKDSMVVQWHEPINNGGSPVIGYHLERKERNS
ILWTKVNKTIIHDTQFKAVNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGT
PEAIMVKRNEITLQWTKPAYDGGSMITGYIVEKRDLPEGRWMKASFTNVIETQFTVSGLT
EDQRYEFRVIAKNAAGTISKPSDSTGPITARDEVELPRISMDPKFRDTIVVNAGETFRLE
ADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGS
KSFPVNVKVLDRPGPPEGPVQVTGVTSEKCTLTWSPPLQDGGSDISHYVVEKRETSRLAW
TVVASEVVTDSLKVTKLLEGNEYIFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLE
VTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTED
HEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYD
GGSEILGYVVEICKADEEEWQIVTPQTGLRATRFEISKLTEHQEYKIRVSALNKAGLGEA
TSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFT
DKVQIEKGVNYTQLSIDNCDRNDAGKYTLKLENSSGSKSAFVTVKVLDTPGLPQNLAVKE
VKKDSVLLVWEPPIIDGGSKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYY
FRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLG
YVVEMQPKGTEKWSVVAESKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAK
DLTIQPSFKLPFNTYTVQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATS
TILHIKESNKDDFGKYTITATNSAGTATENLSIIVLEKPGPPIGPVRLDEVSADFVVISW
EPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKVTKLKTGTEYQFRIFAENRYG
KSAPLDSKPVIVQYPFKEPGPPGTPFVTSISKDQMIVQWHEPVHDGGSKVIGYHLEQKEK
NSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPP
GRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSG
LVEDQRYEFRVIARNAAGNFSEPSESTGAITARDEIDAPNASLDPKYKDVIVVRAGETFV
LEADIRGKPIPDIVWSKDGKELEETTARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNV
GGTKSIPITVKVLDRPGPPEGPLKVSGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSR
LSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESEPVIACNPYKPPGPPS
SPEASAIAKDSMVVTWARPVDDGGAEIEGYILEKRDKEGIRWTKCNKKTLTDLRFRVTGL
TEGHSYEFRVTAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKP
IYDGGAPVKGYMVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGV
GEPATIPGSVVAKERLEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEG
TLTERAQIEVTSSYTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLN
VREIKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATVTNNCTKNTFKIENLQEGC
SYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSK
ITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTAGEEYTFRVAAVNEKGRSDPRQLGVPV
IARDIEIKPSIELPFNTFNVKARDQLKIDIPFKGRPQATVSWKKDGQILKETTRVNVSSS
KTVTSLSIKEASREDVGTYELCVSNSAGSITVPITVIVLDKPGPPGPVHIDEVSCDNVTI
SWSPPEYDGGCQISNYIVEKRETTSTTWHVVSQAVARTSIKIVRLTTGSEYQFRVCAENR
YGKSSYSESKPVVAEYPFSPPGPPGTPKVVHATKSTMIVSWQVPVNDGGSRVIGYHLEYK
ERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCD
PPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIIERRELPDGRWLKCNFTNVQETYFEV
TELTEDQRYEFRVFAKNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEV
LKINADIAGRPLPVISWAKDGVEIEERARTEIVSTDYNTSLTVKDCIRRDTGQYVLTLKN
VAGTRSMAVNCKVLDKPGPPAGPLEISGLTAEKCSLSWGPPQENGGADIDYYIVEKRETS
HLAWTICEGELRTTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESVAVKALDPFTVPSPP
TSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTG
LREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTNITISWVK
PLFDGGAPVTGYTVEYKKSDETEWETAIQNLRGTEYTIGGLTTGAEYVFRVRSINKVGAS
DPSDSSDPQVAKEREEEPVFDLDSEMKKTLIVKAGASFTMTVPFRGRPAPSVLWSKPDSD
LRTRAYIDSTDSRTSLTIENANRNDSGKYTVTIQNTVNAASLTLVVKVLDSPGPPTNITV
HDITKESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKITNLQEGAI
YYFRVSGENEFGVGVPAETKEGVKITEKPSPPEKLGVTGVSRDSVSLTWLKPEHDGGSRI
VHYVIEALEKGQKNWVRCAVVKSTHHIVSGLRENSEYFFRVFAENQAGLSDPRELLLPVL
IKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTE
VTAENLTINLKESVTTDAGRYEITAANSSGTTKAFINIIVLDRPGPPTGPVVISDITEES
VTLKWEPPKYDGGSQVTNYIVLKRETSTAVWTEVSTTVARTTIKIMKLTTGEEYQFRIKA
ENRFGISDHIDSACVVVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSPVIGYHL
EMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGIGKPSHPSEPVLAID
ACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVIETQ
FIVSGLTQNSQYEFRVFARNAVGSVSNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRA
GTSVKLRAGISGKPEPTIEWYKDDKELQTNALVCVENTTDLASILIKDASRLNSGSYELK
LRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKR
ETSRVVWSIVSENLEECIITTTKIIKGNEYIFRVRAVNKYGIGDPLESDPVVAKNAFVTP
GPPGVPEVTKITKNSMTVVWSRPVVDGGSEVSGYFLEKRDKKSLGWFKVSKKTIRDTREK
VTGLTENSDYQYRVCAVNAAGQGPFSEPSDFYKAADPIDPPGPPAKIRIADSTKSSITLG
WSKPVYDGGSAVTGYVVAMRQGEEEEWTVVSTKGEVRTTEYVVSNLTPGVNYYFRVSAVN
CAGPGEPIEMTEAVQAKDILEEPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVIWR
KDEKNLSSDARYNIQNTDSSSLLMIPQVTRNDTGKYILTIENGIGQPKSSTVSVKVLDTP
ATCQKLQVKHVSQGTVTLFWDPPLIDGGSPIINYVIEKRDATKRTWSSVSHKCTSTSFKI
TDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSVKDSTKTSVTLSWTKP
DFDGGSVITEYVVERKGKGEQTWSHAGVSKTCEIEVSQLKEQSVLEFRVSAKNDKGLSDA
VTIGPITVKELVITPEVDLSDIPGAQVAVRIGHNVHLELPYKGKPKPSISWLKDGLPLKE
TEYVRFSKTENKITLSIKNVKKENGGKYTLILDNAVCRNSYPITIITLGPPSKPKGPIQF
DEIKADSVIMSWDVPEDDGGGEITCYSIEKREASQANWKMVCSSVARTTFKVPNLVKDAE
YQFRVRAENRYGVSQPLVSNIIVAKHQFRIPGPPGKPVVYNVTSDGMSLTWDAPVYDGGS
EVTGFHVEKKERNSILWQRVNTSPISGREYRATGLMEGLDYQFRVYAENSAGLSAPSDPS
KFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVAYSIEKRQGSDRWVRCNFT
DVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGVIMTRDENVLPTVEFGPEYFD
GLIIKSGESLRIKALVQGRPVPRVTWFRDGVEIEKKMNMEITDVLGSTSLFVRDATRDHR
GVYSVEAKNASGSSKAEITVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITH
YIIEKRETSRLAWALIEDNCQAHSYTATKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQ
IQYTVPDAPGTPEPSNVTGNSITLTWARPESDGGNEIQQYILERREKKSTRWVKVISKRP
ISETRFKVTGLTEGNEYEFHVMAENAAGIGPASGISRLIKCREPVSPPSAPAVVKVTDTS
KTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKF
RVSAINGAGKGESSEVTGAIKAVDRLAAPELDIDANFKQTHVVRAGASIRLFIAYQGRPT
PTAVWTKPDSNLSIRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVL
DTPGPPGPITFKDVTRGSVTLMWDAPILDGGARIHHYVVEKREASRRSWQAISEKCTRQI
LKVSDLAEGVPYYFRVSAENEYGVGEPYEMPEPIVATEQPAPPKRLDIIDTSNSSAVLAW
LKPDHDGGSRITGYLLEMRQKGSDFWVEAGRTKQMTFTVERLVENTEYEFRVKAKNDAGY
SEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPITGRPAPKVTWKLEEM
RLKETDRVSIITTKDRTTLSVKDSMRGDSGRYFLTLENTAGVKTFTITVVVIGRPGPVTG
PIEVSSVSAESCVLSWAEPKDDGGTDITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLT
KYMEYSFRVSSENRFGVSKPLESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYH
DGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVSGLVEGLEYQFRTYALNAAGVSKA
SEASRPMMAQNPVDPPGRPEVTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEIGDG
RWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKA
ELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAV
IKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPCGNLTVSRVTEEKCTLAWSLPQE
DGGAEITHYIVERRETSRLNWVIVEGECPTLSHVVTRLIKNNEYIFRVRAVNKYGPGVPV
ESEPIVARNSFTIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEINNYLVDKREKKSLRW
TRVNKDYVVYDTRLKVTGLMEGCDYQFRVTAVNAAGNSEPSEACNFISCREPSYTPGPPS
APRVVDTTKSSISLAWTKPMYDGGIDILGYVLEMQEKDTDHWYRVHTKATIRNNEFTVPD
LKMGQKYSFRVAAVNAKGMSEYSESTAEIEPVERLEIPDLELADDLKKTVTIRAGASLRL
MVSVSGRPPPVITWSKKGIDLANRAIIDTTDSYSLLIVDKVNRYDAGKYTIEAENQSGKK
SATVLVKVYDTPGPCPSVRVKEVSRDSVTITWEVPTIDGGAPVNNYIIEKREAAMRAFKT
VTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVVDV
TRSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTILEHTVISLNEGEQYL
FRVRAQNEKGVSEPREIITAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRP
PPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKV
IILDKPGPPTGPIKIDEIDAASITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESV
TRQTFKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSISIPGPPETLQIFDVSRD
GMTLTWYPPENDGGSQVTGYIIERKEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRV
TAINVRGTGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTG
YLIEMQKVDQHEWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVK
VTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDVSKRAMIATS
ETHTELVIKEADRDDSGTYDLVLENKCGKKAVYIKVRVIGNPNPPEGPLEYDDIQARSVR
VSWRPPADDGGADILGYILERREVSKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAEN
QFGISKPLKSEEPVIPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYI
ERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKD
PFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIK
DRQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGVRKEMKDVTTKL
GEAAQLSCQIVGRPLPDIKWYRFGKELVQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCI
ATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPSITWFYGQ
KLLQNSENITIENTEHYTHLVLKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKP
TGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIV
NLTENAGYYFRVSAQNTFGISEPLEVASVVIIKSPFEKPGAPGKPTITALTKDSCVVAWK
PPASDGGAKIRNYYLEKREKKQNKWIAVTTEEIRETVFSVQNLIEGLEYEFRVKCENLGG
ESEWSEISEPATPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGK
EIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIH
LPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLV
FPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPA
SDGGSKITNYIVEKCATTAERWLRVGQARETRYTVVNLFGKTSYQFRVIAENKFGLSKPS
EPSEPTITKEDKTRAMNYDEEVDETREVSMTKASHSSTKELYEKYMIAEDLGRGQFGIVH
RCVETSSKKTYMAKFVKVKGTDQVLVKKEISILNIARHRNILYLHESFESMEELVMIFEF
ISGLDIFERINTSAFELNEREIVSYVRQVCEALEFLHSHNIGHFDIRPENIIYQTRRSST
IKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVHQHDVVSTSTDMWSLGTLVYVLLSGTNP
FMAETNQQMIENIMNAEYTFDEEAFKEISLEAMDFVDRLLVKERKSRMTASEALRHPWLK
QKIERVSTKVIRTLKHRRYYHTLVKKDLNMVVSAARISCGGAIRSQKGVSVAKVKVASIE
IGPVSGQIMHAVGEEGGYAKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVATM
YIKDITKFDDGTYRCKVVNDYGEDSSYAELFVKGVRETYDYYCRRTMKKIKRRTDTMRLL
ERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDDAKYTFESDKG
LYQLTISSVTIDDDAEYTVVARNKYGEDSCKAKLTVTPHPPPTDTTLRPMFKRLLANAEC
QEGQSVCFEIRVSGIPPPKLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYY
RVTATNTAGSTSCQAHLQVERLRYVKQEFKTKEERERHVQKQIDKTLRMAEILSGTETVP
LTQVAQEALREAAILYKPAVSTKTVKGEFRLETEEKKEERKLRMPYEVPEPRKYKQTTIE
EDQRIKQFVPMSDMKWYKKIRDQFEMPGKIDRVVQKRPKRIRLSRWEQFYVMPLPRITDQ
YRPKWRIPKLSQDDLEMVRPARRRTPSPDYDFYYRPRRRSLGDMSDEELLLPIDDYLAMK
RTEEERLRLEEELELGFSASPPSRSPPRFELSSLRYSSPQAHVKVEETRKDFRYSTYHIP
TRAETSTSYAELRERHARASYRQPKQRQRVMAEKEEEELLRPVTTTQRLSGYRSELDHMS
KEEKSRKKSGRQREVTEITEIEEEYEISKHAQREASSKHAQRESESSSSVSRLLRRRRSL
SPTYIELMRPVSELIRPRRPPEEEYEDDTERRSPTPERTRPRSPSPVSSERSLSRFERSA
RFDIFSRYESMKAALKTQKTSERMYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFIL
NVQSKPTAEVKWYHNGVELQESSKIRYTNMSGVLTLEILDCQAEDSGTYRAVCTNYKGEA
SDYATLDVTGGDYTTYTSRRRDEQVPPSVFPELTRTEEYAVSSFKKTSEMEASSSVREMK
SQMTETRESLSAYEHHASAEMRSAAVEQKSLEEKSTHRKIKTTLVGARILTKPRSITVYE
GESARFSCDTDGEPVPTVTWLRGGQVISSSARHQVTTTKYKSTFEISSVQASDEGNYSVV
VENSEGRQEAQFTLTVQKARVTEKAVTSPPSVKSPEPRVKSPEAVKSPKRVKSPEPVTTH
PKAVSPTETKPTPTEKVQQLPVSVPPKITQSLKAEASKDIVKLTCAVESSVLSAKEVTWY
KDGKKLKENGHFQFHFSADGTCELKIHNLTESDSGEYICEISSEGGTSKTNFHFMGQAFK
SIHEQVSRISETKKAAQKTVESTETKKTEPKAPEPISSKPIIVTGLQDATVSSDSVAKFA
VKATGEPRPTVIWTKDGKAVTQGSKYKLSEDKGAYFLEVHKTDTSDSGLYTCTVTNSAGS
VSSSCKLTIKAVKDTEAQKLSTQKTSEITSQKKAAVQEEISQKALISEEMKLAEGKSQEK
AVVQEEISQKALISEEMKKSEVKSQEQLALKEEASKVRISEKVKKSEATSLEKSIVHEEI
TKTSQASEEIRTHAEIKAFSTQMSITDGQKVTLKANIAGATDVKWVLNGVELANSEEYRY
GVSGSDQTLTIKQASHKDEGILTCIGKTSQGIIKCQYDLMLSKALSDAPAFISQPRSQNI
NEGQNVFFSCEISGEPSPEIEWFKNNLPISVSSNISVSRSRNVYSLEIRNASVSDSGKYT
VKAKNFRGQCSATASLTVLPLVEEPPREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFS
SFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSNFMGKSSMTQLESSTSRMLKPGVR
GIPPKIEALPSDISIDVGKVLTVACAFTGEPTPEIIWSRGGRKIQNQEQHGRFHIENTDD
LTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNINIRSM
NT seq 101460 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaagcaccgacgtttcagcagccgttacaaagtgttgtggtactggagggt
agtaccgcaacctttgaggctcacattagtggtttcccagttcctgaggtgagctggttt
agggatggccaggcaatttccacttccactctacccggcgtgcagatctcctttagcgat
ggccgcgctaaactgacgatccccgccgtgactaaagccaacagtggacgatactccctg
agagccaccaatggatctggacaagcgactagtactgctgagcttctcgtgacagcagag
acagcgccacccaactttgttcaacgactgcaaagcatgactgtgagacaaggaagccaa
gtacgactccaagtgagagtgaccggaatccctacacctgtggtgaagttctatcgggat
ggagcggaaatccagagctcccttgattttcaaatttcacaagaaggcgacctctacagc
ttactgattgcggaagcataccccgaagactccgggacctattcagtaaatgccaccaat
agtgttggaagagctacttcgactgccgaattgctggttcaaggcgaagaagtagtaccc
gctaaaaagacaaagacaattgtttcgactgctcagatttcagaaacaagacaaacccga
attgaaaagaagattgaagcccactttgatgccagatcaattgcaacagttgagatggtc
atagatggtgccgctgggcaacagctgccacataaaacacctcccaggatacctccgaag
ccaaagtcaaggtctcccacgccaccgtccattgctgccaaagcacagttggctcgccag
cagtccccgtcgccgataagacactccccttccccggtcagacatgtgcgggcgccaacc
ccgtctcctgtcagatccgtgtctccagcgggaaggatctccacatcccccatcagatcc
attaagtctccactactcacccggaagaccccgacacccggcatggccccaggccccgaa
gtgcctcccccttggaggcaggagggctacgtggcctcctctgaggctgagatgagagaa
accacggtgacgagcgccacccagatcaggaccgaggagagatgggaagggagatacggg
atccaggagcaagtgaccatcagcggaggagcgggcgctgccaccagtgtgtcggccagc
gctgccttcgcggcgggagccgtggctgctggcgctgcagaggcgagacaagaaactgac
aaaagtgcagctgttgcgactgtcgttgctgctgttgatatggccagagtgagagaacca
gtcatcagcgctgtagagcagactgctcagaggacaaccacgactgccatgcacgtccaa
cctgctgaagaacagattaaaaaagaggcagagaagaagacggctgttactaaggtagta
atggccgctgataaagccaaggaacaagaattaaaatcaagaaccagagaagtaattaca
acgaaacaagagcaggtgcacgtaactcatgaacagataagaaaagaaactgaaaaagca
tttgtaccaaaagtaataatttccgcaactaaagccaaagagcaagaaactagagttact
ggacaaattactacaaaacaggaacaaaaacaagtaactcaagaaacaataacaaaagaa
actaggaaaacagtggtacctaaagtcatagttgccacacccaaagtcaaagaacaagat
ttagtatcaagaactagagaaggcatcactaccaaaagagaacaagttcaaataactcag
gaaaagatgaaaaaggaagctgagaaaactgccttgtctacaatagcagttgcaactgcc
caagtagcccaagaacaagaaacaatactgagaactagagaaggaatggctactagacaa
gaacaaatccaagttactcacggaaaggtggacgttgggaaaaaggcggaagctgtagcg
acagtcgttgctgcagtagaccaggcccgcatcagagagcccagggagccgaggcatctt
gaagaatcctatacgcagcagaccactatggagtatggctataaggagcacatttccgcc
acaaaggtagctgagcagcccccgcgtccagcctcggaaccccacgttgtccctaaagca
gtcaagcctagggtgatccaggctccttctgagactcatatcacaactactgatcaaatg
ggaatgcatatttcatcacagatcaagaaaactacagatcttacaactgaaagattagtc
catgtggataaacgcccccgcacagcaagccctcactttactgtttcaaaaatttctgtc
cctaagacagaacatggatatgaggcatcgatagccggtagcgctatcgccacgttacag
aaagagttgtcagccacgtcttctgctcagaagatcaccaagtcggtgaaggcaccgacc
gtgaagcctgctgaggctagagtgagagcagaacccaccccctcaccccagttccccttc
gccgacacaccagacacctacaagagtcaggctggtgttgaagtgaagaaggaggtgagc
atcactggtgacacagttcgggaagaacgcttcaaagtcctacacgagcgtgaaaccaag
gtgacagaaacagcaagggtgcctgcacctgttgaaatcccggttactccaccaaccttg
gtctcgggcttaaaaaatgtgacggttatagaaggtgaatccgtcacgttggagtgtcac
atctctggatacccatccccaaaagtgacatggtacagggaagactaccaaatagaaagt
tccattgatttccagataaccttccagagtggaattgcccgtcttatgattcgcgaagcc
tttgcggaagacagcgggcaatttacctgcagtgccgtgaacgaggctgggactgtcagc
acatcctgctatctggccgtgcaagcatcagaagagtttgaaaaggaaacaaccgtgact
gagaaattgaccacagaagaaaaacgctttgttgagtccagagatgtggtgatgacggat
actagcatcacagaggaacaagcaggacctggagaacctgccgcccctttctttattaca
aaaccggtggtccagaaactggtggaaggtgggagcattgtgtttgaatgtcaggttggc
ggcaatccaaagccccacgtctactggaaaaaatctggtgttcctcttaccacgggatac
agatacaaagtgagttacaacaaacaaactggggagtgcagactggtgatttcgatgact
tttgcggatgatgctggggaatacactattgttattcgtaataagcatggcgagacttcg
gcatctgcctccctgcttgaagaagctgagtatgagtcattgatgaagtcccagcaagaa
atgctttaccaaacacaaatgactgcatttgtgcaagaacctaaagttggagaaatagca
cctggatttttatactctgattatgaaaaagagtatgaaaaagaacaggccttaattagg
aaaaaaatggccaaagatactgtaatggtcagaacttttgtagaagaacaggaattccac
atttcttcctttgaagagaggcttatcaaagaaattgaatacagaataataaagactaca
ttagaagaacttcttgaagaagatggagaagaaaagatggcagttgacgtttctgaatct
gaagctatcgaagcaggatttgacttaagaatcaagaattacagaattctcgaggggatg
ggtgttacttttcattgcaagatgtctggatatccattacccaagattgcatggtacaaa
gacggcaaacgcatcaaacatggagagagataccaaatggactttctgcaagatggcaga
gctagtctgcgcatacctgttgttcttccagaagatgaaggcatctatactgcatttgcc
agcaatatgaaaggaaatgcaatttgctcggggaaattgtatgtcgagcctgctgcgcct
cttgctgctccgacttacatacccaccccagaaccagtgagcagaatcagatctatctct
ccacgttcagtgagtagatctcctatacgcatgtcccctgcaaggatgtcccctgcacgg
atgtcccctgcaaggatgtcccctggacgtaggctggaggaaacagatgagtcacaactt
gagagactctataagccagtctttgtcttaaagcctgcttctttcaaatgtttggaaggg
caaactgccagatttgacttaaaggtcgttggtagacctatgccagagaccttctggttt
cacgatggccagcaaattgtcaatgattatacccataaagtagtcattaaagaagatggt
acccaatcactgattattgtccccgcagcgcccagtgattctggggaatggactgtcgtt
gcccaaaacagggcaggcaaatcttcaatttcagtgattttaactgtggaagctgtggaa
catcaggtaaaaccaatgttcatagaaaaactaaaaaatgtcaatataaaggaaggttct
cgacttgaaatgaaagtcagagctacgggtaatcccaaccctgatatcgtatggctgaaa
aacagtgacatcattgtacctcataaatatcctaaaatcagaattgaaggaaccaaggga
gaagctgcccttaaaattgactccactgtcagccaggattctgcctggtatactgcaact
gctattaataaggctggccgagacactacaagatgcaaagtgaatgttgaagttgagttt
gcagagcctgaaccagagagaaaattaatcatcccacgagggacatatagagcaaaggag
atcgcagccccagaactggagcccctccatctgcgatatggtcaggagcagtgggaagag
ggtgacctctatgataaagagaaacaacagaaaccgtttttcaagaaaaaactcacttcc
ttaagactcaagcgctttgggcctgcccactttgaatgtaggctaacaccaattggtgac
ccaacgatggtggtggaatggctccatgatggaaagccacttgaagcagctaacaggctc
cgtatgatcaatgagtttgggtattgcagccttgattatggagttgcatattccagagac
agtggtatcattacatgcagagctactaacaaatatggaacagatcacacatctgccacg
cttattgttaaagatgaaaaaagtcttgtggaagaatctcagttgcctgaggggaggaaa
ggcttacagagaattgaagaattagagcggatggctcatgaaggtgcacttacaggtgta
acaacagatcagaaagagaagcaaaagccagacattgtcttgttcccagaaccagtaaga
gtacttgaaggggagaccgccagattccgttgccgagtgacaggttaccctcaacccaaa
gtcaactggtacctcaatggacagctgatccgcaagagcaaaaggttcagagttcgctat
gatggcattcactatttggacattgtggactgcaaatcatatgatacaggggaggtcaag
gtcactgcagaaaatcccgaaggtgtgatagagcataaagtgaaacttgaaatccaacag
agggaagattttaggtctgttctcaggcgagcccctgaaccaaagcccgagtttcacata
catgaacctggaaaacttcagtttgaagtacaaaaagtagatagacctgttgataccact
gaagccaaggaagttgtgaaattgaaaagagctgaaagaattacccatgaaaaagtatcc
gaagagtccgaagagctgcgcagtaaattcaagcgcagaactgaggagggatattacgaa
gccattactgctgtggagctcaagtctcgtaagaaggatgaatcctacgaagagctccta
aggaagacaaaagatgagcttctccactggaccaaagaattaactgaagaggagaagaaa
gcccttgctgaagaaggcaagatcactattccaacgtttaaacctgataaaattgaactg
agtcctagtatggaggctcctaaaatatttgaaagaatccaaagccaaacagtgggccaa
ggatctgatgcacacttccgggtcagagtggtgggaagaccagatcctgaatgtgaatgg
tacaaaaatggcgtaaagattgaacgctctgaccgaatctactggtactggcccgaagat
aatgtttgtgaactggtcataagagatgtgactgccgaggactctgccagcatcatggtg
aaagccatcaacatagctggggaaacctcaagccatgcattcttacttgtccaagccaag
caatcaatcattttcacacaggacttacaagatgttgttgctaaggaaaaagacaccatg
gcaacctttgaatgtgaaacttcagagccatttgtcaaagtgaagtggtacaaagatggt
gtggaggttcatacgggagataaatacaggatgcactctgacagaaaggttcacttcctc
tccgtactgacaattgacacatccgatgctgaggactacagctgtgtactcgtggaagat
gaaaatgtcagaacaacagcgaaacttattgtcgaaggtgcagttgttgaatttgtaaaa
gaacttcaggacatagaagttccagaatcattttcaggagagttagagtgcgttatatct
ccagaaaatatagaaggcaaatggtatcataatggcgtggagctgaaatccaatggcaaa
tacacaattacatctcgccgtggacgtcagaacctcacagttaaggatgtgaccaaagag
gaccagggagaatacagctttgttgttgatgggaaaaagacaacctgtaaactaaagatg
aaaccccgccccatcgctatcctgcaaggacttagtgatcaaaaagtctgtgaaggtgac
attgtccagcttgaagtgaaggtctccttggagaatgtggaaggtgtctggatgaaagat
ggccaagaagtgcagcccagtgacagagttcacattgtgatagacaaacagtcccacatg
ctgctcattgaagatatgactaaggaggatgctggaaattactccttcaccattccatcc
ctcggactgtcaaccagtgggcgcgtctctgtctacagtgttgatgtgataactcctcta
aaggatgttaatgtccttgagggtaccaaggctgtgcttgaatgtaaggtctcagttgct
gatgtgacttctgttaaatggtatttaaatgatgaacaaatcaagcctgatgatcgtgta
caagccattgtcaaaggtactaagcagcgactagtgattaaccggacccacgcttcagat
gaaggaccttacaagctgatggttggcaaggttgaaaccagctgtgatctctctgtggaa
aaaattaaaattatcagaggtcttcgtgaccttacctgtacagaaacccaaaatgtggtc
ttagaagttgagctgtcccactcaggaatcgatgttttgtggaattttaaggacaaggaa
atcaaacccagttctaaatataaaattgaagctcatggaaaaatatataagttgacagtt
ctaaatatgatgaaagatgatgaaggagagtacacattttttgctggagaaaatatgaca
tctggaaaacttactgtggcagggggagccatctccaagccactctcggaccagactgtg
gctgaatcgcaggaagctgtgtttcaatgtgaagttgccaacccagattccgaaggcgaa
tggctgaaggatggcaaacacctaccactgagtaacaacgtcaggagtgaatctgatggc
cacaaaaggagacttatcatcgctgccaccaaattagatgacattggagaatacacctac
aaggtggccacctccaaaacatctgccagactcaaagttgaagctgtcaaaattaagaag
actctgaagaacctcacagtgacagagacgcaagatgctgttttcactgttgagcttacg
catcctaacgtaaaaggcgtccagtggatcaaaaatggcgttgtgctgcgatccagtgac
aagtacgacatctcagtcaaaggaacagtttacactctgaggattaaaaactgtgctgtt
gtggatgaatctgtatatggcttcaagcttggaaagctaggagccagtgccaggctacat
gtggagactgtcaagatcattaaaaagccaaaagatgtgaccgccttggaaaattccacc
gttgcctttgaagttagtgtttcccatgacacggttccagtaaaatggttccacaagaat
gtggagattaagccaagtgacaagcacagactggtctcagaaagaaaggtccacaaactg
atgctgcagcatatttccccctcagatgctggggaatatacagctgtggtggggcaactg
gagtgcaaagctaaacttttcgtggagacattacatattacaaaaaccatgaaaaacatt
gaggtacctgagaccaaatctgcctcctttgagtgtgaggtgtcccacttcaatgtccct
tccatgtggctgaagaatggtgtggagattgagatgagcgagaagttcaagatagtcgtg
caggggaaactccaccagctgatcatcatgaacaccagcacagaggactcagcagaatac
acatttgtctgtggcaatgaccaagtcagcgccaccctgaaagtgaccccaatcatgatt
acatccatgctgaaggacatcaacgctgaagaaaaagacaccattacctttgaggtaacg
gtgaactatgaaggcatctcttacaaatggttaaagaatggtgtggaaatcaaatcaact
gacaggtgccagatgagaaccaaaaagctcacgcactcactgaatatcaggaacgttcac
ttcggggatgcagctgagtacaccttcgtggctggaaaagctacctcaacagccaccctt
tacgtggaagctcgccacatagaatttcggaaacacatcaaggatattaaggttcttgag
aagaagcgagccacgtttgagtgtgaagtttctgaacctgacatcactgttcagtggatg
aaagatggccaagagctgccgactgtggacagaataaagatacagaaggagaaatacgtt
caccgcctgctgatcccctccacccggatgtctgatgccgggcaatacgcagtggtggca
ggaggcaacatatccaccgctaacctctatgtagaaggcagagatgtccgcatccgaagt
ctcaaaagggaggttcaggttattgagaaacaacgtgctgtcgttgagtttgaggtcaac
gaagatgatgttgatgcccactggtataaagatggcattgaaatcaatttccaaattcaa
gaacgacatcagtatgtagtggagagaagaatccaccggatgtttatctctgagaccagg
catagcgatgctggtgaatacacctttgtggcaggaaggaacaggagttctgttactctc
tatgtcaatgctccggagccgccccagattctgcaggagctccagcccatcactgtgcag
tctggcaagcctgcccgcttctgcgccgtgatagccggcagaccgcagcccaaaatttcc
tggtacaaggaagagcagctgctttccactggcttcaagtgcaaatttcttcacgatggg
caggagtacacacttctgctcatcgaagccttcccggaggacgcagctgtttacacctgt
gaagccaagaatgactatggagtcgccacaacctccgcttcgctctcagtggaagttcca
gaagttgtgtctccagatcaggaaatgccagtttatcctcctgccgtcatcacccccctt
caggacactgtcacttcggagggacagccagcccgttttcagtgcagagtgtctggaaca
gatctaaaagtgtcttggtacagcaaagacaagaaaatcaagccatctagattctttaga
atgactcaatttgaagacacttaccaactggaaattgctgaagcttatccagaagatgaa
ggactttacacttttgttgctaataatgctgtgggtcaagtatcaagcacagccaacttg
agactggcagccccagaatccattttgcacgggaggattgaagagcagattgaggtgcag
atgaaagctgccccagtgatcaaaaggagaatcgagcccctggaagtagctctgggccac
ctagccaaattcacctgcgaggtccaaactgcccccaatgtccggttccagtggtttaaa
gctggccgagaaatttatgaaagcgacaagtgttcgattcgatcttcgaagtacgtctcc
accctggaaatcctgcgaacccaggttgtggactgtggcgagtacacctgcaaagcctcc
aacgagtatggcagcgtcagcgtaacagccacgctgactgtgacagaggcatatccacca
agcttttactccagacctaagtccgttacaacttttgtgggtaagacagccaagttcctc
tgcacagtattagggactcccgtgatcgaaaccatttggcagaaagatggggctgcgctg
tcaccttcccctaaccgcaagatttcagaggcagaaaataaacacagtttagaactctca
aatcttacaattcaagatagaggagtttattcttgtaaagcttctaacaagtttggagct
gacatctgccaagctgagttaatcatcatcgacaagccgcatttcattaaagaattagaa
tctgtgcaatcagcaatcaataagaagatccacctcgagtgccaagtggatgaagacaga
aaggtgacagtgacatggaataaagatgggcaaaaactcccccccgggaaagattataag
atctattttgaagataaaatagcatcacttgagatccctctggccaaactcaaagattca
ggaacttacgtttgtaccgcttccaacgaagctgggagcagctcctcttcagcaacagtt
accatcagagaaccaccgtccttcgtgaagaaggtggacccctcttatttaatgctgcca
ggtgaatcagcacgcctccactgcaagctgaaaggctcacctgtgatccaggtcacttgg
tttaagaataacaaagaacttagtgagagtaacactattcgaatgtcttttgtcaattct
gaggctgtgcttgatctgacggacgtcaaagttgaagatagtggcagttactcatgtgag
gtggtgaatgacgttggcagtgactcgtgtagtgctgaaatcgttatcaaagagcctcct
tctttcatcaaaacccttgagcctgcagatatagtgagaggaacaaatgcctttcttcag
tgtgaaatctcaggcactggaccctttgaaatcagctggttcaaagacaagaagcaaatt
cgaagtagtaaaaagtacaggttgttttctcagaagtctctggtgtctctggagatcttt
tctttcaatagtgcagacgttggtgaatatgagtgtgtggttgctaacgaagttgggaag
tgtggctgcagtgcaacacacttgttaaaagaaccgccaagctttgtaaagaaagtagat
gattttaccgcactagcaggtcaaactgttaccttacaagctgccgtgagagggtcagaa
cccatctctgtcacctggtttaaaggacaagaaataattaaagaagatggaaagatcaaa
atgagcttttctaatggtgtcgcagtcttgatcatccctgacgttcagattagttttggt
gacaaatacacctgcctggctgaaaacgaagctggaagccaaacgtctgttggggaatta
atagttaaagaacctgccaaaattgtcgagagagcagagctgatccaggtgacagcagga
gacccagccacgctggagtatacagtcacaggcaccccagagctcaagcccaaatggtac
aaagatggaagacctttggttgctagtaaaaagtatcgaataagttttaaaaacaatgtt
gcccaactcaaattttattcagccgaactgcacgatagcggccagtacacatttgagatt
tccaacgaagtgggcagcagctcctgcgaaacaacgttcactgtattagatcgagacatc
gctccgttctttaccaaacccctacgcaacgtgggcagtgttgttaacagcacctgcagg
ctggactgcagagtcgctggctctctccccatgagggtgtcctggttcaaggacggtaga
gaaatagctgcttctgacaaatacagaatagcctttgtggaaggcacggcctctttggag
ataagcagagtagacatgaatgacgcaggcaatttcacttgtcgagccacgaattctgtg
ggaagcaaagacagcagcggagccctgattgtgcaagaaccacccagttttgtaactaag
cctgcatccaaggacgttctgcctggctcagcggtctgcctgaagagcaccttccaaggg
tccacccctttcacagtcaaatggtttaagggtgccaaagagcttgtctctggcggaagc
tgctatattagcaaagaagctttagaaagttccctggaactctatgcagtaaaaacctcc
gattctggcacatacacctgccaagtcagcaatgtcgccggaagcgtggagtgcagcgca
aacttatttgtaaaagagcccgccacgtttgttgagaggttagagccatcacagctgtta
aagaagggagacgccacccagctggcctgcaaagtcactggcacccctccaattaaaatc
acatggtttgcaaatgatagagaaatcaaggagagcagcaagcacaaaatgacttttgtg
gagtccaccgccgtcctaagacttacagatgttgccattgaagacagtggcgagtacatg
tgcgaggcccaaaatgaagctggcagtgaccactgtggtagcattttgatagtcaaagag
tcaccttactttaccaaagaatttaagtccattgaagtgttgaaggaatacgacgtcatg
ttgctggccgaggtggcaggcacacctccctttgagatcacttggttcaaagacaacacc
acgctgagaagtggtaggaagtataaaaccttcattcaggaccagctggtgagcctgcag
atcctcaagttcgttgccacggatgctggtgaataccagtgccgggtgaccaacgaggtg
ggcagcagcacctgcagtgcccgggtgactctgagagaacccccaacctttgtgaagaag
atcgagagcaccagctcccttcggggaggcaccgctgccttccaggccactctcaagggc
tccttgccaatcaccgtgacttggttaaaggacaatgaggaaatcaccgaggacgataat
ataagaatgacctttgagaacaatgtggctagtctgtacctcagtggcatcgaagtcaag
catgatgggaaatatgtctgtcaggccagaaatgatgcaggaatacaaagatgttctgca
ctgctctcagtgaaagaacctgcaacaatcactgaggaggctgtgtctatagatgtcacc
caaggggacccagccactttgcaggttaaattttcagggactaaagagcttacagccaga
tggtttaaagatggccaagaactgaccctgggccaaaaatacaaaatcagcgtcactgac
acagtctctgtactgaagattatttctacagaaaagagagatagtggagaatatactttt
gaggtccaaaatgatgttgggagaagcagctgcaaggctagcattaatgtattagatctt
atcatacctccctcattcaccaaaaagctaaagaaaatggacagcattaaagggtctttt
attgacttagaatgtatagtggctgggtcacaccccatcagcatccagtggttcaaagac
gaccaggaaataacagctagtgaaaagtacaaattctcttttcatgacaatactgccttc
ttggaaatcagtcatctggaaggtacagacagtgggacgtacacctgttcggccaccaat
aaggcaggacacaaccagtgcagtggccatctcacagtcaaagaacccccttacttcgtg
gaaaagccacagtcacaagacgtcagtccccatacaagggttcagctaaaggctcttgtg
ggtggcactgcacccatgaccataaagtggtttaaagataacaaagagttgcactcaggt
gcagctcgctcagtttggaaggatgacacgtctaccctcctggagctcttttcagccaaa
gctgccgattctgggacctacatttgccaactaagcaacgatgttggcaccgcaaccagt
aaagccactctctttgtaaaagaacctcctcaattcattaagaagcccagccccgtatta
gtgctgagaaacggacagtcgacaacatttgaatgccaaataacaggcactcctgaaatc
agagtttcttggtatctggacgggaatgaaataacagccattaagaaatatggcatttcc
ttcatcgatggtttagccactttccaaatttctggtgccagggtagaaaacagcgggact
tacgtctgtgaagcccgcaatgacgcaggcacggcaagctgcagcattgaattaaaagtg
aaagaacctcccacctttatcagggagctgaggcccgtggaggtcgtgaaagatagtgac
gtgcagctggagtgtgaagtggcgggaacgtctccatttgaggtcacttggctgaggaat
aacaaggaaattcgaagcagcaaaaagtataccctaaccgacagagtatccgtgtttaac
ctccatataacccggtgtgacccctcagacactggtgaataccagtgcatcgtatccaat
gaaggcggcagctgctctagcagtacccgggtctccctgaaagaaccaccatcgttcgtg
aagaagatagagaacatcaccactgttttgaaaagctctgccacctttcagagtacggtg
gcaggctctcctctcatttctataacctggctcaaggatgatcacattcttgatgaagat
gataatgttcatatttcgtttgtgaacaatgtggccacgcttcagatcagagctgtggac
aacggacacagcgggagatacacgtgtcaagccaagaacgagtcaggcgttgagcggtgt
tatgctttccttttagtccaagagcctgctcaaatcctagagaaagcgaagtctgttgat
gtcactgagaaagacccggtgactctggagtgcgtagtggccggaacaccagaactcaaa
gtgaaatggctgaaggatggaaaacaaattgtgcctagtagatatttttcgatgagtttt
gaaaataatgtggccagttttaggattcagtcagtcatgaagcaagacagtggtcagtac
acattcaaggtggaaaatgactttggaagcagtagctgcgacgcccacctgagagtgcta
gatcaagatatccctccatctttcaccaaaaaattaaccaaaatggataaagttctgggc
tcttctattcgtatggaatgcaaggtttctggctcacttcctattagcgctcagtggttt
aaggacggaaaagaaatatctacaagtgcaaaatacagacctgtcagtcacgagaacacg
gtgtcactggaagttaataatctggaattagaggatacggcgaattacacatgcaaggtc
tcaaacgtagcaggggatgatgcatgcagtggcatcttaactgttaaagaaccaccaagc
ttcctggtgaaacctgagcgacaacaagccataccggattctacagtagaatttaaggca
gtactgaaaggaacaccaccatttaaaataaaatggtttaaagatgatgtggaacttgcc
tctggacctaaatgtttcattggcttggaagggtcaactagcttcttaaatctctattca
gtggatgcttccaagactggacaatacacttgccaagttaccaatgacgttggtagcgac
tcttgtactacagtgttgcttgtgacagaaccaccaaagtttgtaaagaaattagaagca
tccaaaatagtgaaagcaggtgactccacacgactcgaatgcaagataacgggatcccca
gaaatcagagttgtgtggtacagaaatgaacacgaactccacaccagtaataaatacaga
atgactttcattgacgcagtggccgtcctacagatgaacaatctcagcactgaggacagt
ggggatttcatttgtgaggctcagaatcctgccggcagcacaagctgcagtaccaaggtt
atcgtaaaagaaccacctgtttttagcagcttccctcctgtcgtagaaacccttaaaaat
actgaagttagtcttgagtgtgaattatcgggaacaccaccattcgacgtgatctggtac
aaagacaagcggcagctccgaagtagcaagaaatacaagattgcatccaaaaatttccac
gcaagtattcacattctcaatgttgaagcttcggacattggtgaatactactgcaaagcc
cagaatgaagtcggaagtgatacttgtatttgtactgtaaaattaaaagaaccaccaaga
tttgtctccaaactgaacagcctcacggttgtagctggcgagcctgctgagttacaagca
tccatagaaggagcccagcctatttctgtccagtggcttaaagagaaagaagaagtgatc
agagaaagtgaaaacatcagaattacatttgtagaaaatgttgcaactctgcagtttgca
aaagcagaaccagctaatgctgggaagtatatctgtcaaatcaagaatgatggtggaatg
agggagaacatggccacactgactgttttagagcctgcagtcattgttgagaaagcagga
tcaatgacagtgactgtgggagaaacgtgcactctggagtgtaaggtggccggcactccc
gaactctcggtagaatggtacaaagacggaaagctgttgaccagcagccaaaaacacaaa
tttagcttctacaacaaaatctcttccttaaagatactctctgttgaaaggcaagacgca
ggcacatacaccttccaggttcaaaataacgttggaaaaagcagctgcacagctgtggtt
gacgtttcagaccgaatggtccctccctctttcacccgaagactgagaggtactcttggg
gtgctgggtacttcttgcatcctggagtgcaaagtagctgggtcatcacctatctctgtt
gcctggtttcatgaaaaaactaagattgtcagcggagcaaagtaccaaaccacattctcc
gataacgtctgcacattacagctgaattctctggactcctcggacacaggcaattacacg
tgtgtggccgctaatgccgccggctctgatgaatgtcgtgcagtgttggctgtacaagaa
ccaccctctttcgtgaaggaacctgaacctttggaaatactaccaggcaaaaatgtcacc
ttcacaagcgttattcgagggacccctcccttcaaggtcggctggttcagaggcgccaga
gaactcatgagaggagaccggtgcaacatttattttgaagacactgtggcagaactggaa
ttatttaatgttgacatctctcagagtggggaatacacttgtgtggtttctaacaatgct
ggccaaacgtcctgcacgactcatctctttgtgaaagaaccggctacctttgtgaagaag
ttaagtgatcactctgtagagccagggaagtccataattctggagggcacctacactggg
acacttccgatttcagttgcctggaaaaaggatggtgttaacgtagctccatctgagaga
tgcagcatagtcacaacggagaaaacttgcattctagaaattctcagcagcacaaaaaga
gatgcaggacagtactcctgcgaaattgaaaacgaggcagggagggatgtttgccaagct
ctggtttctacgttagaaccaccttattttgttacggaactagaacccctggaggcatct
gctggagattcagtttctttacagtgccaagttgctgggacaccagaaattacagtgtct
tggtacaaaggagacactaaattacggccaactccggaatacaggacctattttacaaac
aatgtggccacgctggtttttaataaagtgactattaatgacagtggggagtacacatgt
aaagcagaaaatagcataggaactgcttcttctaagactgtcttcagaattcaagagcgc
caactcccaccttcctttgcaagacagctgaaagacattgaacagactgttgggttgccg
gttacactcacttgtcgattaaatggctccgcacccatccaagtgtgttggtatagagat
ggggtacttttacgagatgacgaaaatctacagacgtcatttgtagataatgtggcaact
ttaaaaattttgcaaactgacttgagtcactccggccagtactcctgctcagcttctaac
ccacttggaacagcgtcttctagtgctagactgacagcaagagaacctaagaaatctccc
ttctttgacatcaagcctgtatctatcgatgtcattgctggggaaagtgctgactttgag
tgtcatgttactggtgctcaaccaatgcgaatcacttggtcaaaagataacaaggagata
cgtcctggaggaaattatacgatcacatgtgtgggaaacactccccatctgagaattctt
aaagtaggcaaaggagactctggtcaatatacttgccaagcaaccaatgatgttggcaaa
gacatgtgctcagctcaactcagtgtaaaagaacctcccaagtttgttaagaagctagaa
gcttctaaagttgcgaagcagggagaatccatccaactggaatgcaaaataagtggttcc
ccagaaatcaaagttgtgtggttccgaaatgacagtgaactccatgaaagttggaaatac
aacatgtcattcgttaattctgtggcactgcttaccatcaatgaaggcagcactgaggat
agcggggactatatctgtgaagctcataatggtgttggtgatgccagctgcagcacagcc
ctgaccgttaaagcacctcctgttttcacccagaagcctgctccaataggagctcttaaa
ggttctgatgttatcttccaatgtgaaatttcgggaacccccccatttgaagtggtgtgg
gttaaagatcgaaagcaagttcgaagcagcaagaaatttaaaatcacttcaaaaaatttt
gatacaagtcttcatatccttaaccttgatgcttctgatgtaggagaatatcattgcaaa
gctactaatgaggtgggaagcgacacgtgtgtttgcactgtcaagttcaaagaaccccca
cggtttgtgaaaaagctaagcgacacctcaactcttgttggggatgctgttgagttacgg
gctgtagttgaaggcttccagccaatttctgttgtctggctgaaagataaaggtgacgtc
atcagagagagtgaaaacactaggatttcattcgtcgataatgtcgcaaccctccagctt
gggagccctgaagcatctgattctggaaaatatgtgtgccaaatcaaaaatgatgctggg
atgagagagtgttcagcagtcttgactgtagtagaaccagccagaatcgtagagaggcca
gaacccatgactgtgactactggaaatccttttgctttagagtgtgtagtggctggaaca
ccagaactttcagtcaagtggttcaaagatgggagagaattatctgcagacagcaaacat
cagattacattcatcaacaaagtggcttccattaaaatcccttgtgcagaaatgagtgac
aaggggttatatagctttgaagtgaaaaacagtgttggtaaaagtacctgctctgtatct
gtccacgtgtcggatcgagttgtgcctccttccttcatccgcaagctgaaagacatgaac
gccatcctggggacctcggccgttctggagtgccgagtctctggctcagccccgatttca
gttggctggtttcaggatggaaatgagctcattagcgggcctaaatgccagtccagcttt
tcagaaaatgtctgcacgttgaatctgagcttattggagccctcggacacaggcgtatac
acgtgtgtggctgccaacgtggctggttctgacgagtgctcggccgtcctgaccgtgcaa
gaaccaccatctttcgaacaaatccccgactctgtggaagttttacctggaacgagcctc
atcttcaccagtgtctttagaggcacccctccgttcaaggtcaaatggtttaagggcagc
agggaactggtgtcaggggagtcatgcaccatctctctggaagattttgtgacagaactg
gagttgttggaggtggagccgttgcagagtggagactattcttgcctggtgaccaatgac
gcgggcagtgcctcttgtactgcccatctttttgtgaaagaaccagccacctttgtgaaa
aagttggctgatttcaacgtggagactggaagtcccatagtcctcgaggccacgtttact
ggcacacctcccatctcggtgaactggatgaagaatgagttccttctttcacagtctcag
aactgcagtattaccatgacagagaaatcgacgatcctggaaattacagagagcactata
gaggattatgcccagtacagctgcctgatagaaaatgaggccggtcaagatatttgtgaa
gctctggtgtctgtcctagaaccaccctatttcattgaacctctgcaacacgtagaggca
gccattggagaacccacgactttacagtgtaaagtggatggaaccccagaaattagaatt
tcttggtataaagaacacacaaagctacgatcggctcctgcatataaaatgcaatttaaa
aataacgtcgcctctttagtaatcaacaaagtggaccacagtgacgtgggagagtacaca
tgcaaggcagaaaacagcgtgggggcagtagcttcttccggcgtgcttgttatcaaagag
cgtaaacttccaccttcctttgcaagaaaactgaaggatgttcatgagactcttggtttc
cctgttgcatttgaatgtcgcatcaatggctcagaacctcttcaagtgtcttggtacaag
gatggggtgcttttgaaagatgatgcaaatttgcaaatgtcttttgttcataacgtagca
acccttcagattttgcaaactgaccagagccatgttggtcagtacaattgctcagcttct
aatcctcttggaactgcttcatctagtgccaaactcattctctcagagcatgaagtgcct
cctttctttgatctaaagcctgtatcggtagatcttgctcttggagaaagtggttctttt
aaatgtcatgtaactggaactgcacccatcaaaatcacttgggccaaagataaccgagag
attcgccctggaggcaactacaagatgactttggttgaaaatactgccactctgacaatt
ctcaaagtaagcaaaggcgacgccgggcagtacacctgctacgcaagcaacgttgctgga
aaagactcttgttctgctcacctgggtgtacaagaaccacccaggttcattaagaagcta
gaaacttcaagaatcgtgaaacaggatgaatacacaagatatgaatgtaaaataggaggg
tctccagaaatcaaagttttatggtacaaagacgagactgaaattcaagagagcagtaaa
ttcagaatgtcattcctcgactcggtggcggtgttggaaatgcacaacctcagtgttgag
gacagcggagactacacatgtgaggcccgcaatgcagcaggcagtgcaagcagcagcact
tccttaaaagttaaagaaccacctgttttccgcaaaaagcctcatcccgttgagacgctg
aaaggagctgatgttcatctcgaatgtgagcttcagggtactcccccatttcaagtttct
tggcataaagataagagagaacttaggagtggcaagaagtacaagatcatgtctgagaac
tttctgacaagtattcacatcctgaatgttgatactgcagacatgggggaataccagtgc
aaagccaccaacgatgtggggagtgacacttgtgttggttctatcactctgaaagcacca
ccaagatttgtgaagaagctcagtgatgtttctaccatcgttggtgaagaagttcagcta
cagactgctattgaaggagctgagccaatatcagtggtgtggttcaaagataagggggag
attgttagagaaagtgacaacatatgggtttcttattcagaaaacattgcaaccctacag
ttcgcaagagcagaaacagccaatgctggaaagtacacctgtcagatcaaaaacgatgct
ggaatgcaagagtgcttcgccacactatccgttctcgaacctgcagcgattgtggaaaag
ccagaatccattagagttaccacaggagatacctgtaccttggagtgcacagtcactggc
acacccgaactcagtaccaggtggtttaaggatggaaaagaactgacaagtgacagcaaa
tacaaaataagcttcttcaacaaagtatctggccttaagattatcaatgttgctcctagt
gacagtggtgtatacagtttcgaggtgcaaaaccctgttggcaaagacagctgtacagcc
tcagttcaagtttcagaccgagctgttcctccttcattcacgagaaaattgaaagagacg
aatggtctgtcaggttcctcagttgtaatggagtgcaaagtctatgggtcaccgccaatc
tctgtctcctggttccatgaaggaaacgagatcagcagtggaaggaaataccagaccacc
ctgacagataacacttgtgctttaactgtgaacatgctagaagaatcagatgccggggac
tacacgtgtgtagctactaatgtggctggttctgatgaatgcagcgctcctttgaccgtg
agagaaccaccatcctttgttcagaaacctgaggccatggatgttttaatgggagccaat
gtaactttcacaagcatcgtaaaaggaacacctcctttcagcgtcagctggttcaagggt
agcagtgaattagtaccaggggacaggtgtaatgtgtctctggaggattccgtggccgag
ctggagctgtttgatgtagagacaacacagagtggagaatatacctgcatagtcagtaac
gaggccggcagagcttcttgtacaacacatctctatgtaaaagcgccagccaaatttgtg
aagaggctcaatgactacagcatagagaaaggaaaacccctgattctagagggcacgtac
actggaactcctcccatttcggttacatggaagaaaaatggcataaacgtaactccttct
cagaggtgtaatataaccacaactgaaaaatctgcaatcctggaaattccaagtagcaca
gtggaggatgcaggacaatacaactgttacattgaaaatgcttccggaaaagattcctgt
tcggcacaaatactgatactagaaccaccgtattttgtcaagcagttggagcctgttaag
gtgaccgttggagattctgcctctttacagtgccaaattgctgggacccctgaaataggg
gtgtcttggtacaaaggagataccaaattaagacctacttccacctgcaaaatgcatttt
aggaacaatgtcgctacgctggttttcaaccaggttgatggtagtgacagtggagaatat
atctgcagagctgaaaacagtgtgggagaagtttcttcatcaacgttccttactgttcaa
gagcaaaaactgccaccatcattttctcggcaattgcgagacgttcaagaaacagtcgga
ctgccggttgtgtttgaatgtaccatacatggatcagagcctatctcggtgtcttggtat
aaagacggcaagccattgaaagacagcccaaatgtacaaacatcgtttttagataatgtg
gccactcttaacatctttaaaacagaccggagccttgcgggccagtattcttgcacagct
acaaatcctatagggtctgcttcttctggcgccagactcattctcacagaggggaagaac
ccacctttctttgacatccccgttgcccccgtggatgctgtggtcggggacagtgctgat
tttgagtgccacgttactgggacgcaaccaataaaggtcgcttgggccaaagacaacaga
gagatacgaagtggcggaaactaccagatcagttacctggaaaacatggcccacctgaca
attctgaaagtagacaagggagactctgggcaatatacctgctatgctgtgaatgaagtg
ggaaaggactcatgcacagctcaacttaacataaaagagcggctcattccaccaagcttc
actaaaaaactctcggagaccgttgaagaaacggaagggaattctttcagactcgagggc
cgtgttgccggttcccagcctataacggtcgcatggtacaggaataatatagagctacac
ccaacttctaactgtgagatcacattcaagaacaacacgctcctgctgcacgtcaagaag
gcaggcatgggcgacgctggcctgtacacatgcaaagtgtcaaatgacgcgggctctgct
ctgtgtacatcttcgattgtcatcaaagaacccaagaagccccctgtgtttgatcagcac
cttactccagtaacagcaagcgaaggagaatttgtgcagctcagctgtcatgtgcgggga
tcagaacccatcaggatccagtggctgaaggctggaagggaagtaaagccctcagacaga
tgcagcttcagctttgctcacgggaccgccgtgctggaactgaaggatgtggctaaagca
gattcaggagattatgtgtgcaaagcttcaaatgtggctggaagtgacacttcaaaatca
aaagtgaccattaaagacaaaccagccgcagtcccagcagccaagaaagcggcagtagac
gggaaactcttcttcgtgtcagaacctcagagtatcagagtcgtagaaaaaaccactgca
acattcattgcaaaagttggaggtgatccaatcccaaatgttaaatggacaaaagggaaa
tggaggcaactgaaccaggggggtcgcattcttatccaccagaaaggcgacgaagcaaag
ctggagattagagacaccacaaaaactgattctggattgtatcggtgtgtcgcgtttaat
aaacatggcgaaattgaaagtaatgttaacctgcaggtggatgagaggaagaaacaggag
aagattgagggagatcttagagcaatgctgaaaaagactccaattttaaagaaaggagct
ggagaagaggaggaaatcgatatcatggaacttctcaaaaatgttgatcctaaagaatat
gaaaaatatgcccgcatgtatggaatcactgacttccgaggtcttcttcaagcatttgaa
ctgctaaagcaaagtcaagaagaagagacacacagattggaaattgaggaaatagagaag
tcagagaaggatgaaaaggaatttgaggaacttgtatcatttatccagcaaaggctgtca
cagacagagcctgtcactctgatcaaggacattgagaatcagacagttttgaaagatgat
gatgctgtgtttgaaattgacattaagattaattatccagaaatcaagctttcatggtac
aaagggactgaaaaactggaacccagtgataaatttgaaataagtatcgatggtgatcga
catacactcagagtcaaaaactgtcaacttaaagatcagggcaattatagattggtgtgt
ggtccacacatcgctagtgctaaactaactgtaattgagcccgcttgggaacggcatctt
caggacgttactttgaaagaaggccagacttgcaccatgacatgccaattttccgtgcca
aacgtaaaatctgaatggttcagaaatggcagaatccttaagccccaaggtagacataag
acagaagtggaacacaaagtccataagctgaccatcgcagacgttcgagcagaagaccag
gggcagtatacctgcaaatatgaagaccttgaaacttcagcagagctcagaattgaagct
gaaccaattcagtttaccaagcgcatacagaacattgtggtgagcgagcatcagtcggcc
acctttgaatgtgaagtgtcctttgatgatgccattgtaacatggtacaaaggaccaaca
gaactgactgagagccagaagtacaacttcaggaatgatggtcgctgccattatatgacc
atccacaatgtgaccccagatgatgaaggtgtctattcagtaatcgctcgactggaaccg
agaggtgaagcaagaagcacagcggagctgtacttaacgacgaaagaaatcaagcttgag
atgaagcctcctgatattcctgactccagagttccaatcccaaccatgcctatcagagca
gtacctccggaagaaatccctcctatggttgttcctcctattcctctgttgctaccatca
cctgaagaaaagaaaccaccagcgaaacgcattgaagtgaccaaaaaagctgtgaagaaa
gataccaaaaaagttgtcgcgaagcccaaagaagaacctaaagaggttgacaagaagccc
ctgcctcctattgccttgattccagcaaaagctcctgaaattgttgatatatcctccaaa
gctgaagaagtaaaaataacaaccataaccagaaagaaagaggttcacaaagaacaagaa
gctgtgtatgagaagaagcgcgccgtctacgaggagaagaagcttttcatcgagtctctg
gaagaaccttatgacgaactggaagtggaaccgtacacggagccgtatgaggaaccttac
tatgaagagccagacgaagactatgaggagaccaaggtagaagcgaagagggaagttcac
gaggaatgggaggaagacttcgaggaaggccaggagtactacgaaagggaggaaggttat
gacgaaggggaggaagactgggaggaaacttaccaagagagagaagtggtccaagtgcaa
aaggaggtttatgaagaatcgcacgagaggaaaatcccagcaaaagtccctgaaaagaaa
gcaccgcctccaaaagttgtaaagaagccagtagttgaaaaaattgaaaagacttctcga
agaatggaggaacagaaagttcaagtcaccaaagtacctgaagtttcaaagaagattgtt
ccacaaaaaccttctcggactccagtgcaggaagaagttattgaagtgaaagtaccagct
gtgcatacaaagaagatggttatttcagaagaaaagatgttctttgcttctcacgcagag
gaggaggtgtcagtcacagtccccgaggtacagaagaaaactgttaccgaagagaaaatt
catgttgctgtttccaaaaagattgagcctccacctgaagtccctgaactacctaagaaa
ccagtcccagaagaagtggttgctgttcccattcctaaaaaggtggagcccccaccaacc
aaagttcctgaagttcccaagaaacctgtaccagaggagaaaaagcctgttcctgttcct
aaaaaggaaccacctgctcccccaaaagtcccagaggtgccaaagaaacctgttcctgaa
gaaaagatacctgttcctgttgcgaagaaaaaggaagtcccaccagctaaagttcctgaa
gtacagaagaaggttgtcacagaagaaaaaataaccattgttactcaaagagaggaatca
ccaccaccggcagtgccagaaataccaaagaagaaagttcctgaagaaaaaagacctgtt
cctcaaaaagaggaagaagttccaccaccaaaagttccacgtaagaaacccatccctgaa
gagaaagttcctgtcccagttcctgtggctaagaaagctcctcctccccgagctgaaatt
tctaagaaaaccgtggtagaagaaaaaagattcgctgccgaagaaagactgtctgttgca
gttcctcaaacagtggaactcaggcgacacgaagaggaggagtggagttattcagaagaa
gaggaaagagtatccgtttcagtttatagagaagaggaaagagaggaagaggaagtggag
gttacagagtatgaagtgatggaagagcctgaggaatacgttgtggaagaaaaggtgcac
tttatctctaagagagtggaagccgaaccagcagaagtggtggagaagcatgagaagaag
gtcgtactgaaaccgaaagttcctgctaaaattgaggagcccccaccagcgaaagttcct
gaagtaccaaagaaacctgtgccggaaaagaaagtccctgctgcagttcccaaagcggaa
aaggtgccaccagtgccggaagagccaaagaagccagttccagaaaaaagggttcctcca
aaagtggctaagaaagaagaacctccccccaccaaagtgactgagaggcacatgcaaatt
actcaagaagaagaagttcacgtcgctgtaactaaaaaagaggagcctccaagagcaaga
gtgcccgaggaacccaagagagctgttccagaagaaaaaattccaaaactcaaacctagg
agagaggaggaaccaccggcaaaagtcactgaactcagaaaaagagctgttaaagaagaa
aagatatccattgaagttccaaaaagagaagctcctcccgtgaaagaagtaaccgtaact
gaagagaaagcatggtcttacacccgggaagaagaaattgtttcagtagagcgggaagag
gaatatgacgaatatgaagaatatgattataaagaacttgagtatgaaccaacagaagaa
tatgaccagtatgaagaatacgaggaacgtgaatttgaacattatgaagagtataaagag
cacgaagaatacgtcacagaacccaagaagcctctcccagtaaagcctgtccaagaagaa
ccagttcccaccaagccaaaggccccaccaactaaagtgctgaagaaaccagtccctgaa
gaaaaagtcccagtgcccattcccaagaaactcaaacctccaccacccaaagtgcctgaa
gaagcaaagaaagttgttgaagaaaaaatacacatttcaattaccaaacgtgaaaaagag
caggtggctgagccagctgttaaagtgcccatcaagcccaagagagttgtcacagaagaa
aaagtacttgttcctaaaaaagaagtaacagcacctgttagagtggcagaagtactaaaa
agacaagaacaagaagagattgtctttgaagaggaagttgtaacccacgtagagaaatat
tttgaagaagaagaagaagaagaaaaagaagaggaagaggaagaggaagaggaggaggag
tacattcatgaagaagaggaacttgcaactgaagaagaagttgtaccggtgataccagcc
aaagtgcccgaaatacccaagaaacctgtaccagaagagaagaaacctgttcctgttccc
aaaaagaaggaagccccaccagcgaaagtgcctgagattcctaagaagccagaggagaaa
gttcctgtgcccattcctaaaaaagagaagcctccaccagctaaagttcctgaagtgccc
aagaaacctgtaccagaggagaaagtgccagtaccggttcctaaaaaggtggaagctcca
cctgccaaagtgccggaagtgcccaagaagccagtgcctgagaagaaggtgctagttcct
gttcctaagaaggtagaggccccacctgcaaaagtgccagaggtgcccaagaagatcatc
ccagaggaaaagccaacacctgttccgaaaaaagtggaagctccaccacccaaagtgcca
aagaaacgtgagccagttccagttcctgtagctctacctcgggaagaagaagttccattt
gaagaagaaattgctcctgaagaggaagttctccctgaggaagaggaagttctccccgag
gaagaggaagttcctcctgaggaagaggaagttcctcctgaggaggaagaatttatacct
gaggaagaagttgaacctgaagaagaggaagttcttccagaaattaaacctaaggtgcca
gtgcctgcacgagtgcctgaagtcccaaagaaacctgtacctcagaagaaagtccctgtt
cctgctcctaaaaaagtggaacctccaccacccaaagtgcctgaggttaagaagaaagtg
ccagagaagaaagtggtcattcctaagaaagaggaggctcctcctgccccagtgcctgtg
gtgcttaagaagccggaaccagaaaagaaagtgcctcctcctggtgttaagaaagcagtg
gctcctcctgccaaagtccctgaggtacctaagaaagtggaagaaagacgaatcattctc
cctgaagaagaggaagtgccaccagttgaagtgtatgaggagccagaagagcctattcca
gaagaagagatccctgaagaaccacctagcattgaagaggttgaggaagtggcgccacct
agagtgcctgaagtggttaagaaagcagtacctgaggcacctactcctgttcctaaaaaa
gtggaggcaccgccagctaaagtgccaaagaaggttcctgaggaaaaagtgcctgttcct
gttcagaaaaaagagccacctccagccaaagtgcctgaaaagaaagtcccagaaaagaaa
atcgcagaaaagaaagtccctgtgcctaaaaaagaagctgttcccccagctaaagggagg
accgtccttgaagaaaaaatatcagttgccttccacaaagaggaggtggtaagagagaga
acagaattagaaatagtggaaacaccagtggaagtgcttgaggaggaagagttccatgaa
gttcaagaatattttgaagaagaagaattccacgaagtagaagaattcatcaaagtggag
cgacctagagttgaagatgtacacagagctgaagaggtccatagggtaatagaggtttta
gagacagaagaagtggaagtatatgaaaaacccaaagctccacctaaagggcctgagata
tctgagaaaatcatccctccaaaaaaaccacccactaaagtcgttcctcgaaaagagcca
ccagctaaagtacctgaagtgcccaagaaaattgtggtagaagaaaaagtacgtgttcct
gaagagcccgaatttccaccagctaaagcacctgaagtacccaagaaaattgttccagaa
gaaaaggttcgtgaagctgttcctaaaaagcctgaagttccaccaactaaagtgcctgag
gctcccaaggaagttgtccctgagaagaaggtggctgtgatgcctcctaagaagccggaa
gtcccacctgttaaagtgcccgaggctcctaaagaagttgtccctgaaaagaaggtgcct
gtgatgcctcccaaaaagcccgaagtcccaccagccaaagtgcccgaggtgcccaaggca
gctgttccagaaaagaaggtgcctgaagctgttcctcccaaaccggagagtcctccccct
gcagtgcctgaggtaacgccagaggaagtcatccctgagaagaaagtacccgtggctcct
cctaaaaagccagaggctccacctgctaaagttcctgaagctcctgaagaagttgtcccc
gaaaagaaagtgtctgtggttgtgcccaaaacaccagaagccccacctgctatagtgcct
gaagttgctcaagaagttgtcccagaaaagataattcccaaggcaccgcccaaaacacca
ggagccccacctgtcacagtgcctgaagttgctcaagaagttgtcccagaaccaaaattt
cccaaggcaccacctaaaaaaccagaagcccgaccagtttcagtgcctgaatttcctcaa
gaaattgttccggaaaagaaagcaccaatggtgcctccgaaaaagcctgaagttgcacct
gttaaagtgcctgaggctcccaaagaagttgtccctgaaaagaaggtgtctgtggcactt
cctaaaaagccagaagtcccacctgttaaagtgcctgaggctcccaaagaagttgtccct
gaaaagaaagtgtctgtggcacttcctaaaaagccagaagtcccacctgttaaagtgcct
gaggctcccaaagaagttgtccctgaaaagaaagtgtctgtggcacttcctaaaaagcca
gaagtcccacctgttaaagtgcctgaagttcctcaagaaattgtccctgaaaagaaagca
ccagtggtgcctccgaaaaagcctggagttgcacctgttacagtgcctgaagttcctcaa
gaagttgtcccagaaaagaaggtgtctgtggcacttcctaaaaagccggaagtcccacct
gttaaagtgcctgaggctcccaaggaagttgtccctgagaagaaggtgcctgtgatgcct
cctaaaaagccggaagtcccacctgctaaagtgcctgaggctcccaaggaagttgtccct
gagaagaaggtgcctgtgatgcctcctaaaaagccggaagtcccacctgctaaagtgcct
gaggctcccaaggaagttgtccctgagaagaaggtggctgtgatgcctcctaagaagccg
gaagtcccacctgttaaagtgcccgaggctcctaaagaagttgtccctgaaaagaaggtg
cctgtgatgcctcccaaaaagcccgaagtcccaccagccaaagtgcccgaggtgcccaag
gcagctgttccagaaaagaaggtgcctgaagctgttcctcccaaaccggagagtcctccc
cctgcagtgcttgaggagcccgaggaagctgcctgggaagagcccacagtggaagttgtg
gaagagccagagcccatcgctcctccagaagtgaccgtgccacccaagaaacctgtccca
gaaaagaaaccacctgctgtcattgccaaaaaacctgaaccaccaccagtgaaagtgccc
gaggtacccaaggaagttgttcctgaaaagaaggtgcctccagtggttcccaaaaaaccg
gaagtcccacctgctaaagtgcctgaagttccgaaagaagttgctcctgaaaagaaagta
actgttcccaagaagccagaagtcccaccacctaaagtgccagaggtgccaaagaagcct
gccgtagaagaggaacccgcggttcctgcccccaaggaagtagagccccctgcggaagta
tatgaagagcctgaggaaattgctgctgaagaggaagagccagttcctgttgctgaagag
gagccagaagccccaccaccagcagtacctgaagaacccaagaagattgttccagagaag
aaagttcctgttatcaaaaaaacagaagctccacctcccaaagaacctgaacctgaacct
gaaaagaaggttattgagaaaccaaaactcaaaccgaagcctgcggcgcctcctcctgct
ccaccaaaggaagatgtgaaggagaaaatattccaacttaaagctgttccaaagaagaaa
gttcctgaaaaacctgaagttccagaaaaagtggagcttaagcctctgaaagtgcctgga
gttgaaaagaaagttcgcaaattacttcctgaacctaaacctcagccaaaagaagaagtt
gttctcaaaagcgttctaagaaagaggcctgaagaagaagaacctaaagtagaacctaaa
aaactagaaaaaattaaaaaaccagtaccagagccacctccgaaagctgttgaagaggct
gaagtacctccagctcctgttaccaaaagggaaaggaaagttcctgaaccagtaaaagtg
cctgaaattaagccagcaatacctctccctgcgcctgaaccaaaaccaaagcctgagcca
gaagtgaaaataatcaaaccacctccggtggagcccccgcccacccccatcgccgcccca
gtgacggtgcccgtggtcggaaagaaagcagaagccaaagcacctaaggaggaggctgcc
aagccaaagggtcccatcaaaggtgtcgccaaaaagactccttcaccaatagaagctgaa
aggaaaaagttaagaccaggaagtggtggcgagaagcctcctgatgaagccccattcact
taccagctaaaggctgtgcccctgaagtttgtgaaagaaatcaaagacatcgtcttgact
gaagcagagtcagtggggtcttctgccatctttgaatgtttagtctccccctccactgca
attacgagctggatgaaagatggtagcaatatccgtgagagcccaaagcacagattcatc
gcagatggtaaagacagaaagctgcatatcatggatgtccagctctctgatgccggcgaa
tacacctgtgttttacgtttgggaaataaggaaaagacctccacagctaaacttgttgta
gaagaacttcctgtgcgtttcgtgaaaacacttgaagaggaagtcacagtggtcaaagga
cagccgctgtacttgagctgtgagttaaacaaagaacgcgatgtcgtctggaggaaggat
gggaagattgtggtggagaaacctggcaagattgtgcccggcgtcattggcttgttgcga
gccctgaccatcaatgacgcagatgaccaagacgctggaacatacacagttactgtggaa
aatgccaacaacctggaatgttcatcctgcgtcaaagtagtagaagtcatcagagactgg
ctggtgaaaccaatacgagatcagcatgtgaaaccgaaggggacggctgtttttagctgt
gtaatagcaaaggatactccaaacattaagtggttcaaaggatatgatgaaatcccgttg
gaaccgaatgataagactgagatagtcagagaaggaaaacaactattcctcaaagtcaag
aatgctacaccagaagatattgatgaatatgcggtggaaattgaagggaagagatacccc
gcgaagctgacacttggagatcgtgaagttgaattgcttaaaccaatagaggacgttacc
atttatgagaaagaaagtgcaagctttgatgcagaaatctcagaggcagacattcctgga
cagtggaaactgaagggagaacttcttcggccttcacctacctgtgaaatcaaagcggaa
ggtggaaaacgcttcttaactttgcacaaagtcaaactggaccaagctggagaagtcctt
taccaggcacttaatgcgtttaccactgccatcctgacagtaaaagaaatcgaacttgac
tttgctgtgcccctgaaggacgtcactgttccagaaaggcgacaagctcgatttgaatgt
gtcctcactcgagaggcgaatgtgatatggtctaaaggacctgatataatcaaggcatct
gacaagtttgatatcattgttgatggaaagaaacacattcttgtcatcaatgattctcag
tttagcgacgaaggggtttatactgctgaggtggcgggcaagaagagctcagcacgatta
tttgttacaggtataaggttgaaattcatatcgcctcttgaagaccaaacagtgaaagag
ggcgaaacagcaactttcgtttgtgagctttctcatgaaaaaatgcacgtagtctggttc
aaaaatgatgccaaactccacacgagcagaaccgtactcatctcatctgagggcaagact
cacaaactggaaatgagagaagtgacactggatgatatatcccagataaaagctcaagtt
aaggacctgagctccaccgcaaacctgaaggtcttagaggccgatccctatttcactgtg
aaattacacgacaaaactggagtcgagaaggatgagattattctgaagtgtgaagtgagc
aaagacgtgccagtgaaatggttcaaagatggtgaagagattgtaccttcaacaaaatac
tctatcaagtcggatggcctgcgccgcgtcctaaaaatcaaaaaggcagaccttaaagat
aaaggcgaatacatgtgtgactgcggcaccgaccagacaaaagcaaatcttaacgttgag
gcccgactgataaaagtggaaaaacctctgtatggagtagaattgtttgtcggtgaaaca
gctcgctttgaaattgaactttctgaaccagatgttcacggccagtggaagttaaaagga
gagcctttaactgcttctcctgactgtgagatcattgaagatgggaagaagcatattctg
gtcctttacaactgccagctggatatgacaggggaggtctccttccaggctgccaatgcc
aaatctgcagccaatctgaaagtgaaagaactgccactcatcttcatcacgcctctcagt
gacgttaaagtctttgagaaagatgaggcgaagtttgagtgcgaagtgtcaagggagccg
aaaacattccgttggctgaaaggaacccaggaaatcacaggtgacgacaaagttgagctg
ataaaggacggcactaaacattccttggtgatcaagtcagctgcttttgaagatgaagga
aaatacatgtttgaagctgaagataaacacacaagtgccaaactgatcattgaaggaatc
cgactcaaattcctcaccccactcaaggatgtaacagccaaagagagggagagtgctgta
ttcactgtgcatctgtcccacgataacatccgggttaagtggttcaagaacgaccagcgc
ctacacaccagcaggtcggtctggatggacgatgaagggaagactcattccatcacattc
agagacctcactatcgatgatacctctcaaattaaagtggaagctatggggctaagttca
gaagctaaactcacagtgcttgagggagatccatactttaccggaaagcttcaagattac
actggcgtagagaaagatgaagtggttctacagtgtgaaattagcaaagcagacgcaccg
gtgaaatggtttaaggatgggaaggaaatagagccatctaaaaatgtagttattaaggca
gatggcaagaagcgcatactcatcctaaagaaagccttgaaatcggatattggacagtat
acctgcgactgtggcacagataagacctcaggaaagcttaacatcgaagatcgggagatc
aagctggtgcggcctctgcacagtgtggaggtgatggagactgagacggcccgctttgaa
accgaaatctctgaggaggatatccatgccaactggaaactcaagggagaggcactactc
caaacacctgattgtgagatcaaggaagaaggcaaaatgcacttcctgattttgcacaac
tgccgcctggaccagactggcggggtggatttccaagctgccaatgtgaaatctagtgcc
cacctccgagtgaaaccacgagtaattggtcttctgaggcctctgaaggatgtcacggtg
accgcaggggagacagccacctttgactgcgagctctcttacgaggatatcccggtggaa
tggtatctcaaagggaagaaactcgagcccagcgataaggtggtcccacgttcagaagga
aaagttcatacacttactctaagggatgtaaagttagaagatgctggagaagtccaacta
agagcaaaagatttcaaaactcatgccaatctcttcgtgaaagaaccccccgttgagttc
actaagcctcttgaggaccagacggtcgaagaagaagccaccgcagttctagagtgtgaa
gtatccagagaaaatgctaaggtgaaatggttcaaaaacgggacagaaattctcaaaagc
aagaagtatgaaattgtggctgatggcagggtcagaaaacttattatacacggctgtacc
ccagaggatattaaaaagtacacttgtgatgctaaggattttaagacttcctgtaacctg
aacgtcgtgcctcctcatgtggaattcttaagaccactcaccgatcttcaagttaaagaa
aaagaaatggctcggtttgagtgtgaactttccagagaaaatgctaaggttcagtggttt
aaagatggtgctgaaattaaaaagggcaaaaaatatgacatcatatctaagggagcagtg
cgcattcttgtcatcaacaaatgtctcctggatgatgaagcagaatattcctgcgaagta
aggacagcaagaacttctggcatgctgaccgtactggaagaagaagctgtctttacaaaa
aatcttggcaacgttgaagttagcgaaacagacactataaaactggtttgcgaagtctcc
aagcccggagcagaagtggtttggtacaaaggggatgaggagatcattgaaacaggaaga
tatgaaatccttaccgagggacgaaagagaatcctgaccattcagaacgctcatcttgag
gatgctggcagctacaactgccgactcccaagttcgcgaactgatggcaaagtcaaagta
catgaacttgctgccgaatttatctcaaagcctcaaaaccttgaagtacttgaaggagaa
aaggctgaatttgtctgctctatatcaaaggaaagctttgaagtccagtggaagagggat
gataagacacttgaatctggagacaaatatgacatcattgctgatggcaaaaagaggatc
ctggttgtaaaagatgccacattacaagatatggggacttacgtagtcatggttggagcc
gccagagcagcagctcacttgacagtaattgaaaaactcaggatcatagttcctcttaag
gacactcgtgtaaaggaacaacaagaagtcgtcttcaactgtgaagtcaatacggaaggt
gccaaggccaaatggttcagaaatgaagaggccatatttgatagttcaaagtacattatt
ctccaaaaagacctggtctacaccctcagaattcgaaatgcacgattagatgatcaagcc
aattatagtgtgtctctgaccaatcacagaggtgaaaatgttaagagtgctgctaatcta
atagtagaagaggaagaccttaggataattgagcctcttaaagatattgaaacaatggag
aagaaaacagtcacattctggtgcaaggtgaatcgcctcaatgtaacactgaagtggacc
agaaatggagaagaggtgcctttggacaaccgtgttttatacagaattgataaatataag
cactctctaatcattaaagactgtggcttccctgatgagggtgaatacatggtcaccgct
ggacaagataaatctgttgctgagcttctgatcatagaagccccgacagaatttgtagag
cacttagaagaccagacagtcactgagtttgatgatgcagtcttctcttgccagctctcc
agagagaaggcaaatgtgaaatggtacagaaatggaagagaaatcaaagaaggcgaaaaa
tacaaatttgaaaaagatggacgtacacatagactcattataaaagactgcaggctggat
gatgaatgtgaatatgcttgtggagtagaagacagaaaaactcgggccagactttttgtg
gaagaaatccctgttgagatcatcaggcctccccaagatattctcgaagcccctggtact
gatgttgtcttttgggctgagctcaacaaagataaggtggaagttcagtggctaagaaat
aacatggttattgttcagggtgacaaacaccagatgatgagtgaaggaaagatacacagg
ctacagatttgtaatattcaacctcgtgaccagggtgaatacagatttattgccaaagac
aaagaagccagagctaagcttgaactggcagctgcacctaaaatcaagacagatgatcaa
gatcttgtggttgatgttggccagcctctgacgatggtggtgccctatgatgcctaccct
aaagcagaagctgagtggtttaaagaaaatgaacctctgtcttcaaaaactgttgatact
acagctgaacaaacttctttcaggattttagaagctaagaaaggagacaaaggaaggtat
aaaattgtgcttcagaacaaacatggaaaagcagaaggattcatcaatttaaaagttatt
gatgttccagggccagtacgtaacttagaagtgacagaaacatttgatggtgaagtaagc
ctcggttgggaagagccattaactgatggtggaagcaaaatcataggttatgttgttgaa
agacgtgacgtcaaaaggaagacgtgggttctggcgactgatcgtgcagacagttgtgag
tttactgtcactggactacaaaaaggtggagttgagtacctattccgtgtcagtgcaagg
aacagagttggcactggtgaaccagtagaaacggataatcctgtagaagcaaggagtaaa
tatgatgttccaggccctcctttgaacgtagccatcactgatataaatagatttggggtc
tcactgacatgggagccaccagagtatgacggaggagctgtgatcacaaactacgttatt
gaattaagagataagacttctatcagatgggacactgccatgacagtaagagctgaagac
ctatccgcaactgtcactgatgtggtggaaggacaagagtacagtttccgggtcagagcc
caaaaccgaattggagtggggaaaccaagtgcggccacgccctttgtcaaagttgctgat
ccaattgagagaccaagtcctcctgtgaacctaacttcctcagatcagactcagtcatca
gttcagctcacatgggagcctcctctgaaagatggaggaagcccaatattgggttatata
attgaacgatgtgaagaaggaaaagataattggattcgttgcaataagaaacttgtccct
aaactgacttaccaggttactggattacaaaaaggaaataaatacttatatcgagtatct
gcagaaaatgaagctggtgtttcagatccatctgaaattcttggtcctctaactgctgat
gatgcatctgttgaaccaacaatggatttaagtgcatttaaagatggcctggaagttatt
gtcccgaatcctatcacgatcctggttccaagtacaggctatccaaggccaagtgcaacc
tggtcttttggagataaagtactagaagcaggggaccgtgtgaaaataaaaaccttatct
gcctatgctgaacttgtcatttctccaagtgaacgtccggacaagggcatttatacactg
aaattagaaaatcgcgtgaaagcaatttctggagaaattgatgtcaatgtaattgctcgc
ccaagtgcacccaaagaactgaaatttggtgacataaccagagactcagtacatttgact
tgggaaccaccagatgatgatggaggaagtccattaactggatatgttgttgaaaaacga
gaagtcagccggaaaacatggactaaagttatagactctgtgactgacctagaattcaca
gttcctgatcttgttcaaggaaaagagtatttatttaaagtctgtgctcgtaacaaatgt
ggccctggagaacccgcatatgttgatgaacctgtaaatatgtcagttcctgcaacggta
cctgacccaccagagaatgttaaatggagagatcgaacagccaacagcatctttctaaca
tgggatccacctaaacatgatggtggttcacgcatcacaggctatatagttgaaaaatgt
ccacgtggctctgatcgatgggttgcctgtggagaaccagttgcagaaacaaaaatggaa
gtgacaggtcttgaagaaggtaaatggtatgcctaccgcgtgaaggccttgaacaggcaa
ggtcctagcaaaccaagcaaacccacagatgaaatccaggctgtggatacacaggaggcc
ccagaaatcttccttgacgtgaagctcctcgctggtctcaccgtaaaagcaggaactaaa
attgaacttcctgccactgtaactggaaaacctgaacctaaaataacttggacaaaggcc
gatatgcttttgaagcaggacaaaagaatcaccattgaaaatgttcctaagaaatccaca
gtgaccatcatggatagtaagaggagtgacaccggcacatacatcatcgaggccgtgaac
gtctgtggtcgggccactgcagtggtggaagtgaacgtcttagacaaacctggaccacca
gctgcttttgacgtcacagaagtgaccaatgaatcatgccttctaacatggaacccacca
cgcgatgatggtggatctaaaatcacaaactatgttgtggagagaagagcgactgacagt
gaagtatggcacaagctctcatcaactgtcaaggatacaaactacaaggcaaccaaatta
acacccaacaaagaatacatcttcagagtggctgcagaaaacatgtatggtgttggtgaa
ccagttcaagcctctccaataacagctaaatttcagtttgatccacctggacctccaact
cgccttgaaccttctgatatcactaaagatgcagttactctcacatggtgtgagcctgac
gatgatggtggcagcccaatcactggatactgggttgaaagattagatcctgatactgat
aaatgggtcagatgcaataagatgccagtaaaggacacaacatatagagtgaaaggtctc
accaataagaaaaagtacagattccgtgtgttggctgaaaatcttgctggacctggaaaa
ccaagtaaaacaactgaaccaatcttaataaaggatcccatagatcctccatggcctcct
ggaaaaccaactgtgaaagatgtaggcaaaacatcattgatgttgaattggacaaagcca
gaacatgatggaggggcaaagattgagtcttatgtcattgaaatgctaaagaccggaaca
gatgactgggtccgagtggctgaaggtgttcccaccactcagcatttgctcaccggtctc
atggaagggcaggaatactcattccgagtcagagctgtaaacaaggctggagaaagtgag
cccagcgaacccagtgaccctgtgctttgcagggaaaaactatatcctccatcaccacct
cgctggcttgaagttattaatatcacaaaaaatacagcagacctcaagtggacagttcct
gagaaagatggagggtcccccatcaccaactacattgtggaaaagagagatgtgaggcga
aaaggctggcaaacagtggacacaactgtcaaggacaccaagtgcaccgtaaccccactg
acagagggctctttatacgtattccgagttgctgcagaaaatgccataggacaaagtgac
tactgtgaaattgaagactctgtcctggccaaagatacctttaccacccctgggccaccc
tacgctcttgcagtggttgatgtaaccaagcgacatgttgacctgaagtgggaaccaccg
aaaaatgatggtggacgaccaatacagagatatatcattgagaagaaagaaaagttaggt
acccgttgggtgaaagctggaaagacctcaggacctgactgtaacttcagagtaactgat
gtcattgaaggaacagaggtccagtttcaggttcgggcagaaaatgaagcaggcgttggt
cacccaagtgaacccacagaaatcctggcaattgaagatccaacaagtcctccttcacct
ccccttgacttgcatgtgactgatgctgggcgaaagcacattgccattgcctggaagcct
ccagagaaaaatggtggaagtcctattataggataccatgttgaaatgtgtccagtaggc
actgagaaatggatgcgagttaattctcgccccataaaagacttgaaattcaaagttgaa
gaaggtgttgttcctgacaaggagtacgttctgagagtgagagctgtcaatgctgttggt
gtcagtgagccatctgaaatctccgaaaatgtggttgccaaagacccagactgcaagcca
acaattgacatggagacacatgacattgttgttattgaaggtgaaaagttaagcattcct
gttcccttccgagctgtcccagttccaaccgttagttggcataaagatggcaaagaagtc
aaagcaagtgatagattaacaatgaagaatgatcacatctctgcacaccttgaagttccc
aagtgtgtccatgcggatgctggagtttataccattacgctggagaacaagctcggctca
gcaactggaaaaatcaatgtcaaagtcataggcctacctggaccatgcaaagatattaaa
gcaagtgacgtgaccaagagttcttgtaaattaacctgggaacctccagaatacgatggt
ggaagcccaatccttcattacgtcctggaacgcagagaggctgggaggaggacatatata
ccagtcatgtctggtgagaacaaactggcttggaccgtaaaagatctcataccgaacggt
gaatacttcttccgtgttaaagctgtcaacaagattggtggaggcgaatatattgaactg
aaaaatccagtcattgctcaagatccaaagcagccccctgatccacctatagatgttgag
gttcataatcctacagctaaggcaatgactattacgtggaagccgcctttgtacgatgga
gggagcaaaataatgggttacatcatagaaaagattgctaagggtgaagacaaatggaag
agatgcaatgaacacctagtacctgtcctgacctatacagcaaaaggacttgaagaggga
aaggaataccaattccgagtgcgagcagaaaatgctgctggcattagtgaaccttctcgg
gccactcctccaaccaaagctgtagatcctattgatgccccgaaggtcattatgagaaca
agcctcgaagtgaaacggggtgatgaaatcgcacttgacgcaaccatctctgggtcacct
tacccaactattacgtggctaaaggatgaaaaagtcattacaccggaagaaattaagaag
cgagtagcacccacaattaggaggaagaggggtgaagttcaagaagaggaggaaccattt
gtcctgcagctgacagaacgtttgagtatcgacaacagtaaaaagggagaatctcagcta
cgggtccgagattctctccgacctgaccatggcctgtatatgatcaaagctgaaaatgac
catggtattgccaaagctccttgtactgtctgtgtgctggatacaccgggaccaccaatc
aactttgtatttgaagatattagaaagaactccgtcctctgtaaatgggaaccacccctt
gatgatggtggcagtgaaattataaactacactttggaaaagaaagacaagacaaaacct
gactcagagtggattactgtcacttcaacacttagacactgcaaatactcagtgacaaaa
ctgattgaaggaaaagagtacctctttcgtgtaagagctgaaaataggtttgggcctgga
ccaccatgtgtttcaaagccacttatagctaaagatccatttgaaccacctgatgcaccc
gataagcccattgtagaagatgtaaccagcaacagtatgctagtgaaatggaatgaaccg
aaagataatggaagtcccatcttgggttattggcttgaaaaacgtgaggttaatagtaca
cattggactcgtgtcaacagaagccttctgaattctttgaagaccaacgtagaaggccta
ttagaaggactcacctatgtcttcagagtatgtgccgaaaatgcagctggacctggaaag
ttcagtcccccttcagatcccaaaacagcacgtgatccaatctctccaccggggccacct
gtcccaagagtcacggacacaagctctacaactattgatctagaatgggaacccccagct
ttcaatggtggtggggaaattgttggctactttgttgataagcagctggttggcacaaat
gaatggtcacgctgcacggagaagatgatcaagccccgtcagtacactgtcagagaaatc
cgagagggtgctgattataaacttcgagtgagtgctgtcaacgctgcaggtgaaggacca
ccgggagagacaggacctgttactgtggctgaaccacaagagcctccgagcgtggaacta
gatgtttctgtcaaagctggaatacaaataatggctggaaagactctgagaattccagct
gtggtaactggtcgtccggtgcctaccagagtatggaccatagaagaaggggagctggat
aaagaccgtgttgtaatagagaacgttggaaacaaatctgatctaattatcaagaatgca
ttgagaaaagatcatggcagatacgtgatcacagctaccaatagctgtggttccaaatct
gcggcagccagagtagaaatttttgatgttcctggaccagttcttgacttaaaacctgtt
gtaacaaacagaaagatgtgtttacttaactggtctgatcccgcagatgatggaggaagt
gaaatcacaggtttcattattgaaagaaaagatgctaagatgcatacctggagacaacca
attgagactgagagatctaaatgtgacatcacaggcctcattgaggggcaagaatatatg
ttccgtgtgattgccaagaacaagtttggctgtggccctcctgttgaaataggaccaatt
cttgcagttgatccactaggtcctccaacgtctcctgagaggctcacatacacagaaagg
acgaagtccactatcacccttgactggaaagagccccgcagtaacggtggcagtcccatc
caaggctatatcattgaaaaacggcgtcacgacaaacccgactttgaaagagttaacaag
cgactctgcccaaccacatctcttctggttgaagatctcgatgaacaccaaatgtatgaa
ttccgtgtcaaagccgtcaatgccgttggggaaagtgaaccatccctgcctcttaatgtg
gtcatacaagatgacgaagtgcctccaactattaagttgcgcctgtctgttcgaggagac
actatcaaagttaaggcaggagagcctgttaacatccctgcagatgtgacaggccttcca
atgcctaagattgagtggtccaagaatgaaactgtgattgaaaaacccactgatgcactt
aagataacaaaggaagaagtatcccgaagtgaggcaaaaactgagcttatcattcccaaa
gccgtccgggaagacaaaggcacttacaccattactgcttccaatcgcctgggttcagtg
ttccgaaacgttcatgtggaagtatatgatcgtccatcaccaccaagaaatcttgctgtt
actgacattaaagctgaatcttgctacttgacatgggatgcccctctagacaatggtggc
agtgaaatcacccattatgtcattgacaaacgtgatgcaagcaggaagaaaagtgaatgg
gaagaagtcaccaactctgctgtagagaggaaatatggggtctggaaacttatccccaac
ggtcagtatgagttccgagttagggcagtgaataaatatggaatcagtgatgactgcaaa
tcagataaagttgtcattcaagatcccttccgcctccctggacctccgggaaaaccaaaa
gttctggagcgcaccaaagggtcgatgctagtgagctggactcctcctctggacaatgga
ggctctccaattactggctactggctggaaaagcgagaagagggaggtgcctactggtca
cgtgttagccgagcaccaataaccaaagtgggattgaaaggcgtggaattcaacgttccc
cgcttgattgaaggtgttaaataccagttcagagcaatggcaataaatgctgcaggagtt
ggtcctcccagtgaaccatcagatccagctattgcaggagatcctatatatccacctggg
ccaccttcttgcccagaggtcaaagataaaacaaagtccagcatctcgctggcatggaaa
cctccagccaaagatggtggcagtccaatcaaaggatacattgtagagatgcaagaagaa
ggcagtactgactggaaaaaagtaaatgagccagacaaactgctaaccacctgtgaatgt
gtggtgccaaatctgaaagaactccgcaagtacagattcagagtgaaagctgtcaatgaa
gccggggaatccgagccaagcgatacaactggagagatccctgccacagacattcaagag
gttccagaagtttttattgacattggagcacaagactgtctggtttgtcaagctggctcc
caaattaggattcctgctgtcatcaagggacgcccaacaccaaaatcatcgtgggagttt
gatggaaaggcaaagaaggcagtgaaggatggagttcatgacgtacctgaggatgcacag
gtggagactgctgaaaactcatcagtaattattattccggaatgcacacgagctcactca
ggcaaatacagcatcacagccaagaataaagcaggacagaagacagcacattgcagagtc
aaagtcatggacgtaccagggccacccaaagatctgaaagtcagtgacatcacaaggggt
agttgcagactcacatggaagatgccagatgacgatggaggagacaggatcaaaggctat
gttatagagaagaagactattgatggaaaagcctggactaaggtcaatccaaactgtgga
agcaccacatttgtggttcctgatctcatctctgaacagcagtatttcttccgcgtgcgt
gcggaaaaccgttttggtgttggtccacctgcagaaaccattcagaggaccacagccaga
gatccaatatatcctcctgacccccccattaaactcaagattggcctcgtaacaaagaac
accgtacacctatcatggaaacccccaaagaacgatgggggctcccctgtcacgcactat
attgttgagtgccttgcatgggaccctactgggaaaaagaaagaggcatggaaacagtgc
aacaagcgtgatgtggaagaactggaatttactgttgaagacctcatcgagggtggccag
tatgaattcagagtcaaggctgtcaacgctgcaggagtcagcaaaccttcagccactgtg
ggcccagtgactgtcaaagaccagacatgcccaccatcaattgagctaaaagaattcatg
gaggttgaagaaggaacagatgttaacattgtggccaaaattaaaggtgtgccattccca
gcactgacctggtttaaagctcctccaaggaagcctgacaaaaaagaacctgttgtctat
gacacccacgtcaacaaactggtagtggatgatacgtgcaccttagttattccacagtct
cgcaggagtgacactggcttatataccatcacagctgtgaataatctgggaacagcatca
aaggagatgagactgaatgtcctcggtcgtcctggccctccagtgggaccaataaagttt
gaatctgtttcggcagatcaaatgacattatcttggcttccacctttggatgatggaggg
tctaagattacaaactatgtaattgagaagagagaggctaataggaagacatgggtgcgt
gtctctagtgaacctaaggagtgcatgtacacaattcccaaattgctagaaggccatgaa
tatgtgttccgaatcatggcccagaacaaatttggcattggggagcctcttgacagtgaa
cctgaaacagcaagaaacctcttctctgtccctggagcaccagataaaccaaccgttagc
agtgtgactcgcaactccatgactgtcaactgggaagagccagaatatgatggaggctct
cctgtgacagggtactggctagaaatgaaagacaccacttcaaagagatggaagagagtt
aaccgagatcctatcaaagccatgactttgggtgtttcttataaagtgactggtcttatt
gaaggttctgattatcagttccgtgtgtatgcaatcaatgctgctggtgtgggccctgca
agtctgccatcagacccagtgactgctagagatccaattgcccctcctggtcctccaatt
cccaaagtcacagactggactaaatcatctgtggatttggagtggtctcccccactaaaa
gatggtggatccaaagtaactgggtacatcgttgaatataaagaagaaggaaaagaagaa
tgggaacagggtaaagataaagaagtgagaggaacaaagcttgttgtgacagggttaaaa
gaaggagctttctacaaattcagagttagagcagtcaacattgccggcattggagaacct
ggagaagtcacagatgtcattgaaatgaaggacagaattgtgtcacctgaccttcagcta
gatgccagtgtcagagacagaattgtggtccacgctggaggggtgatccggatcatcgcc
tatgtgtctggaaaaccttctccaactgtcacctggaacatgaatgaaagagcattacct
caagaagctaccatagagaccacagccattagctcctccatggtcatcaagaattgccag
aggagccaccaaggtgtctactcccttcttgccaaaaatgcagggggagaaagaaagaag
accattatcgttgatgtattagatgtgccaggtcctgttggaacaccattccaggctcac
aacctaaccaatgactcctgcaaactgacatggttttctccagaagatgatggaggctct
ccaatcaccaattatgtcattgagaagcgtgaatctgaccgcagagcatggaccccagtg
acatatacggttacccgacaaaatgctactgtccaaggtctcattcaaggaaaagcctac
tttttccgaattgcagccgaaaacagtgttggcataggcccatttactgagacaccaact
gcacttgtcatcagagatccaataactgtaccagagcgtcctgaagatctggaagtcaaa
gaagttactaaagattctgttactttgacttggaatcctcctaagtatgatggtggatca
gaaattattaactatgtcgtagaaagccgactcattggaactgagaagttccacaaggtt
acaaaggacaacttgcttagcagaaaatacaccgtgaaaggcttaaaagaaggtgatacc
tatgagtaccgtgtcagtgctgtgaatatcgttggacaaggcaaaccatcattttgtacc
aagccaatcacttgcaaggatgacctagctcctccaacgcttgaccttgacttcagagat
aagctcacagttcgggttggtgaagcttttgccctcactggccgttactcaggcaaacca
aagcctaaaatcacttggttcaaagatgaagctgacgtgctagaagatgatcgcactcac
ataaagaccactccgacgacacttgctctagagaagatcaaggccaaacgttcagattct
ggcaaatactgtgtggttgtggagaacagtacaggctctaggaaaggtttctgtcaagtc
aatgttgttgaccgtcctggaccaccagtaggaccggttatttttgatgaggtgaccaaa
gattacatggttatctcttggaagccacctttagatgatggaggcagtgaaattaccaat
tacattattgagaagaaggaggtgggcaaagacatttggatgcctgtgacatctgcaagt
gctaaaacaacatgcaaagttcctaaactccttgaaggaaaagattatattttccggata
tatgctgaaaacctgtatggaataagtgatcctctggtgtctgattccatgaaagccaaa
gatcgtttcagggttcctgatgcacctgagcagccaattgttacagaagttaccaaagac
tctgcattagtaacctggaacaagccaaatgacggaggaaagcccatcacaaactacatc
ctggaaaagagggaaactatgtctaaacgatgggctagagttaccaaagagcccatccat
ccatacactaaattcagggttcctgatcttctagaggggtgtcagtatgaattccgggtt
tctgcagaaaatgaaattggtattggagatccaagcccaccatccaaaccagtctttgct
aaagatccaattgctaaaccaagtccacctattaaccctgaagcaattgatacaacatgt
aattcagtcgatctaacctggcagccaccacgtcatgatggtgggagcaagattctgggt
tatattgttgagtaccagaaagttggagatgaagaatggaagagagctaatcacactcct
gagtcatgtcctgaaacgaaatataaagtcactggtcttcgggatggtcaaacctataag
ttcagagtcagggcagttaatgaagctggtgaatcggatccagctcatgttcccgagcca
gtgctagtaaaagacagacttgaaccccccgagttgattcttgatgccaacatggcacga
gaacaacacataaaggttggtgatactctaagacttagtgccgtcatcaaaggcgtgcca
ttcccaaaagtaacttggaaaaagggagacagagaggctccgactaaagcaagaattgat
gttactccagttggtagcaagcttgaaattcccaacgctgcccatgaagatggtggaatt
tattctttaacagtggagaatccagctggttcgaaaactgtctcagtaaaagtcctcgta
ttagataagccggggccacctagagatctggaagtcagtgaaattaggaaagattcttgt
taccttacttggaaggaaccactggatgatggtggttctgtcattacaaattatgtggtt
gagaggagagatgttgccagcgcccagtggtcacctctttcagctacatccaagaaaaag
agtcacatggctaaacaccttaatgaaggcaatcagtatctcttccgggtagctgccgag
aaccagtatggacgtggtccttttgttgaaacacctaaacccatcaaggctctggatcct
ctacatcccccagggccacccaaaaacttacaccatgtagatgttgacaagactgaagtc
tcccttgtttggaataagcctgatcgtgatggcggctctccaatcactggatatttggtg
gaatatcaagaagagggcaccgaagattggatcaagttcaagactgtgacaaacttagag
tgtgttgttactggactgcaacaagggaagacctatagattccgtgtaaaagctgaaaat
attgtgggtcttggtctccctgacacaactatcccaatagaatgtcaagaaaaactagtg
cctccatctgtggagctagatgtgaaattaattgaaggccttgtggtaaaagctggaact
acagtcaggttccctgccatcataagaggtgtacccattcccactgccaagtggacaacc
gatgggagtgagatcaaaacagatgaacactacacagttgaaactgacagcttctcatca
gtacttaccattaagaactgcttaaggaaagacactggggaatatcaaatcacagtttcc
aatgcagctggcaccaaaacagtagctgtacatcttactgttcttgatgttcctggtcca
ccaacaggtcctattaacattctggatgttacccctgaatatatgactatctcatggcag
ccacctaaggatgacggaggaagccctgtgataaattatattgttgagaaacaagataca
aggaaaggcacatggggtgttgtttcatcaggaagcagtaagacaaagctgaaaatccca
catctgcaaaaaggctgtgaatacattttccgagtcagagcagagaataagatgggtgtt
ggccctccccttgactccgtacctactgttgctaaacataagtttagtcctccatctcct
cctggtaaaccagtggttactgacattactgaaaatgctgcaacagtgtcttggactctg
ccaaaatctgatggtggcagtccaataattggttactatgtggaacgtcgagaagtaact
ggcaaatgggtgagagtcaacaaaacacccatacctgacctgaagtttagagtgactgga
ctgtatgagggaaatacatatgagtttagggtttttgctgaaaatcttgcaggactaagc
aatccatcaccaagttctgacccaataaaagcttgccggcccatcaaaccacctggacca
cctattaatcctaaattgaaagacaagaccaaagaaacagctgacttggtgtggacaaag
cctctcagtgatggtggtagccccattctaggctacgtagtggaatgtcagaaacctggt
acaacacagtggaataggattaataaagatgaactcattaggcagtgtgcctttagggta
cccggactaattgaaggaaatgagtacagattccgtataaaggcagctaatattgtggga
gaaggagagcccagagaattagcagaatctgtgattgcaaaagacatccttcatcctcca
gaagtcgaacttgatgtaacttgtcgtgatgttattactgttagagtgggccaaactatc
cgcattcttgctcgagtcagaggcagacctgatccagacataacttggtccaaggaaggc
aaagtattggtccgagaaaagcgggttgacataattcaggatctacctcgtgttgagtta
caaattaaagaagctgttagagctgatcatggcaagtatattatctcagctaagaatacc
agtgggcatgcccaaggttccgccattgttaatgttcttgacagacctgggccttgccag
aatttaagggttagcaatgtaaccaaagagaactgtacaatttcttgggaaaacccacta
gataatggtggctcagaaataacaaatttcatagtggaatatcgcaaaccaaaccagaaa
ggctggtcaattgttgcttcagatgccactaagcgattaattaaggccaacctcttagcc
aacaatgaatactatttccgagtttgtgcagagaataaagtaggtgttggtccaaccatt
gaaacaaaaactccaattctggctattaaccctattgatagaccaggtgagcctgaaaac
cttcacattgcagataaaggaaagacatttgtctatctcaagtggcggcggcctgattat
gatggtggtagcccaaatctgtcctatcacgttgaaaggaggctgaagggctccgatgaa
tgggaaagagtacataaaggaagcattaaagaaacccaatatatggttgacagatgtgtt
gaaaaccagatttatgagttcagagtgcaaacaaagaatgaaggtggggaaagtgactgg
gtgaagacagaggaagttgttgtgaaagaagacttacagaaaccagtacttgatctgaaa
ttaagtggtgtgctaacggtcaaagcaggggacaccattagacttgaggcaggtgttaga
ggcaaaccattccccgaagttttatggaccaaggacaaagatgctacagacttaacaaga
tcaccaagggtcaagattgataccagtgctgattcatccaaattttctctttctaaagca
aagcgaagtgatggtggtaaatatgtaattacagcaactaacacggctggcagttttgtg
gcctatgccactgtcaatgttttagataagcctggtcctgtaagaaatctgaaaatcgtt
gatgtgtccagtgatcggtgtactattcactgggacccaccagaggatgatggtggctgt
gaaatccaaaattatattctagaaaaatgtgagagtaagcgaatggtttggtctacctat
tctgctaatgtcttaacacccggtgctacagtaacacgtctcatagaaggaaatgaatat
attttcagagtccgtgcagaaaataaaataggcacagggcctccaacagaaagtaaacca
gtcattgcaaaaaccaaatatgacagacctggtcgtccggatcccccagaagtcaccaaa
gtaagcaaagaagagatgactgtggtttggaatccacctgaatatgacggtggaaaatcc
atcacaggatactttttggagaaaaaggaaaaacattcagtacgatgggtccctgttaac
aagagtgcaatccccgagagacgtctcaaagtacagaacctcctcccaggacatgaatat
cagttccgtgtcaaggcagaaaatgaaattggagttggagaaccaagcttgccctcaagg
ccagtggtggcaaaagaccccatagaaccacctggtccaccaaccaatctcaaagtggtc
gacacaaccaaaagttccataactcttgggtggggaaaaccagtgtacgatggtggcgca
ccaataattggatacgttgtggaaatgagaccaaaacgagaagatgcatcacctgatgaa
ggctggaaaaggtgcaatgctgcagcacaacttgttcgcatggagttcactgttaccagc
ttggatgaaaaccaggaatatgagttcagggtgtgtgcccaaaaccaagctggcatcggg
cgccctgcagaactaaaggatgctattaaacctaaagaaattctagaacctccggagatt
gatttggatgccagcatgagaaaactggtcacagtgagagcgggatgccctatccgacta
tttgccatagtgagaggacgaccagctcctaaagtcacttggcgaagagtgggtattgac
aacgtggtcagaaaaggacaagtcgatctggttgacactatggccttccttgtcatcccc
aattccacccgtgatgactcgggaaaatattccttgacacttgtgaacccagcaggagaa
aaggccgtgtttgtgaatgtcagagtattagatactcctgggcctgtgactgatttaaaa
gtttcggatgtcactaaaacgtcatgccacatttcctgggcccctcctgagaatgacggt
gggagccaagtgacacattatattgtggagaagcgtgaggcagagagaaagacatggtca
acagttaccccagaagtcaagaaaacgagcttccaagtcaccagcctcgtccctgggaat
gagtacttcttcagagtcactgctgtcaatgaatacggccctggcgtgccagcagatgtc
cccaaaccagtgcttgcatcagatcctctgagcgaaccagatcccccaaggaaactagaa
gttactgaaatgaccaagaacagtgctaccttagcctggttacctcccctgcgtgatgga
ggtgctaaaatcgatggctacatcattagttacagagaagaggagcagcctgcagatcgc
tggacagagtactcagtggtaaaagatctcagccttgtcgtcactggcctaaaggaagga
aagaagtataaatttagagtagcggccagaaacgctgttggagtcagtttgccaagggaa
gctgaaggagtctatgaagccaaagaacagctgttgcctccaaagatccttatgccagag
caaattactattaaagctgggaagaaactccgtgttgaagcccatgtgtatgggaagcct
catccagtctgtaaatggaaaaaaggagaagatgacgttgtcacttccagccacctggca
gtgcataaagcagacacctcttcaatcctgatcataaaagatgtgactaggaaagacagt
gggtactacagcctcactgcagagaacagttctgggacagacactcaaaaaatcaaagtt
atcgtcatggatgctcctgggccccctcagcctccgtttgacatttctgacatagacgct
gatgcttgctccctgtcatggcacatccctctggaggatggaggcagtaacatcaccaat
tacatagtggagaaatgtgacgtgagccgaggggactgggtgacagctctagcctcggtg
acaaaaacttcctgcagagttggaaaactgatcccaggccaggagtatatcttccgggtc
cgtgctgaaaatcgatttggcatttcagagcctctcacatctccaaagatgctggctaag
ttcccatttggtgttcctagtgaaccgaagaatgcacgagtcactaaagtcaacaaagac
tgcatatttgtggcatgggacagaccagacagtgatggagggagtcccgttaccggttat
ctgattgaacgcaaagaaagaaacagtttgctctgggtgaaagctaatgatactcctgtc
cggtcaaccgaatatccttgtgctggccttgtagaaggtcttgagtattcattcagaatc
tatgcactaaacaaagctggatccagcccacccagcaaaccgacagaatacgtaaccgca
agaatgccagttgatcctcctggaaagcctgaagttattgatgtttccaagagtactgta
tccctcatctgggctcgtccaaaacatgatggaggcagcaaaatcattggctactttgta
gaagcttgcaaacttcctggtgataagtgggtgcggtgcaatacctcacctcaccagatt
ccccaggaagagtacacagtcactggcttagaagagaatgctcagtatcaatttagagca
attgccaagactgcagtaaacattagcccgccctctgaaccttctgatccagtgaccatc
caggcagaaaatgttccccccaggatagaactgagtgtggctatgaaatctttgcttacc
gtgaaagctggaactaatgtttgcctggatgctaccgtttttggtaaaccaatgccaacc
gtctcttggaagaaggagggcacactactgaaaccagcagaaggcataaagatggccatg
aagcggaacttatgcaccctggagctgttcagtgtgaaccgaaaggactcaggcgactat
accattactgccgaaaattcgagtggttccaaatcagccaccattaagcttaaagtatta
gataagccgggtcctccagcatctgttaaaatcaacaaaatgtatgcagatcgtgcaatg
ctttcttgggaacctcctcttgaagatggaggctcagaaatcaccaactatattgttgac
aaacgtgaaacaagcagacccaactgggcacaagtctcggctacagtgcccatcaccagc
tgcactgtggagaaactcatagagggccatgaatatcagttccgaatttgtgcagagaat
aaatatggagtgggcgatccaatcttcactgaaccagcaattgctaaaaacccatttgac
ccacccgggcgctgtgatcctcctgttattagcaacataaccaaagatcacatgacggta
agctggaaaccaccagcagatgatggcggctcacccatcactggctatttggttgaaaag
cgagagacccaggcagttaactggactaaagtcaacagaaaacctgttatagaaagaaca
ataaaagcaacaggtctccaagaaggcaccgaatatgagttccgagttacagctataaat
aaggctggaccagggaaacccagtgatgcatccaaagctgcttatgcccgggaccctctg
tatcctcctggcccaccggcttttcctaaagtatatgatacaacccgtagctctgtgagt
ctatcttggggcaagccagcctacgacggtggtagccctatcattggctaccttgttgaa
gtaaaacgagctgactctgataactgggtgaggtgcaatttaccagagaagctacagaaa
acccgctttgaggttactggcctaatggaagacacagaatatcagttccgcgtgtatgcc
gttaataagatcggatacagtgaccccagtgatgtgccagacaaacaccgtcccaaggac
atcttaattccacctgagggagaactcgatgccgatttgaggaaaacactcatattacgt
gctggagttacaatgagactgtatgtaccagtaaaagggcgtccacccccaaagataact
tggtctaaaccaaacgtcaatctaagagaaaggattggacttgacataaaatcaacggat
tttgacactttcttgcgctgtgaaaatgtgaacaaatatgatgcaggaaaatatatcttg
actctggagaacagctgtggtaaaaaggaatataccatcgtagtgaaagtgcttgatact
cctgggccacctgtcaatgtcactgttaaggaaatatccaaagattctgcttatattacc
tgggatcctcccattattgatggcggaagtcccatcataaactatgtggtggaaaaacgt
gatgcagagaggaagtcctggtctacagtgacaactgagtgctcaaaaacaagcttcaga
gtgtctaacttggaggagggaaaatcctacttcttcagggtgtttgctgaaaatgagtat
ggcatcggcgatcctggtgaaacacgtgatgccgtcaaagcttccgaaacccctggacca
gttgtggacctgaaagtgttatctgtaactaagtcatcttgtagcataggctggaaaaag
cctcgcagtgatggtggtagtcgaattactggatacgtagtagatttcctgactgaagac
aataagtggcaacgtgttatgaaatcattaagcttacagtactctgcaaaagatttgact
gaaggcaaggaatataccttcagagtgagtgctgagaatgaaaatggagaaggaaccccc
agtgaaatcattgcagtggcaaaggatgatattgtggctcctgaccttgacttaaaggac
atacctgatttgtgctacttggctaaagaaaatagcaacttccgtcttaagatccccata
aaaggcaagccagctccatcagtatcctggaagaaaggggaagatcctctaccaactgac
acaagagtcagtgttgagtcaactgcagttaacactactcttgtggtacatgattgccaa
aaatctgatgctggaaaatacacaatcacactgaagaatgttgctggcaccaaggaagga
actctctctataaaagttgttggcaagcctggcatacccacggggccaatcaaatttgaa
gaagtcacagcagaagccgtgaccttaaagtggggtcctccaaaggatgacggaggttct
gaaatcaccaactatatcctagagaagagagattctgtaaacaacaagtgggtgacgtgt
gcctcagctgtccagaaaaccacctttagagtaaccagacttcatgagggcatggaatac
accttcagggtcagtgctgaaaataaatatggtgtaggagaaggcttgaaatcagagcca
attgttgctaaacatccatttgatgtgcctgatgctcccccacctcccaacatcgtggat
gtcagacatgactcagtatctctaacttggactgaccccaggagaactggtggctctcca
attacagggtatcatatagagttcaaggaaagaaacagccttttgtggaagagagctaac
aagacgcctattaggatgaaagacttcaaagtgacaggattaactgaaggtcttgagtac
gaattccgagtcatggcaatcaatttagcaggagtaggcaagccaagcctgccatcagag
ccagttgtggcactcgatccgattgatcctcctggcaaacctgaggttattaatgtaaca
aggaattcagtgaccctcgtttggactgaacccaaatatgatggtggtcataagttgact
ggatatatagtggagatgcgggacctaccctctaaaacttggacgaaagccaaccatgtt
aatgtcccagattgtgcctttactgtaactgaccttgttgaaggtggaaaatatgaattc
agagttagagcgaagaatacagcaggtgctatcagtgctccatcagaaagtacaggaacc
attatctgcaaggatgaatatgaggcaccaaccattgtcctcgatcccacaataaaagat
gggctgacaattaaagcaggagataccattgttttgagtgccattagcattcttggcaag
ccccttccaaagtcgagttggtctagagcaggaaaagacattagaccatcagatattgtt
cagatatcttcaaccccaacatcttccatgcttactgtcaagtatgccactagaaaagat
gctggtgaatataccattactgctacaaatccttttggcacaaaggaggaacatgtgaag
gtaacagtccttgacgtacctggtcccccaggtcccattgaaatcagtaatgtttctgct
gaaaaagcaacactcacatggacacctccattggaggatggtggctcaccaattaagtcc
tatgttcttgaaaagagagaaaccagccgactcttgtggacagtggttgctgaagatatt
cagacttgcaggcatgtggccaccaaacttatccaaggaaatgagtacctcttccgggtc
tcagctgtaaaccagtatgggaaaggagaacctgtacagtctgaacctgtcaaaatggtg
gacagatttggtccccctggccctcctggaaaaccagaagtatcaaatgtcactaaaaac
actgccactgtcagttggaaaagaccagttgatgacggtggtagtgaaatcacaggatat
catattgaaaggagagaaaagaaaagcttgcgatgggtgagagcaaccaagacgccagtt
tcagatctcagatgcaaagtaacaggactgcaagaaggaaacacctatgaattccgtgtc
agcgcagaaaacaaagcaggaattggtccacctagtgatgcctcaaatcctgttctgatg
aaagatgtagcatatcccccaggcccaccttcaaatgcacgtgtcactgatactaccaaa
aagtctgcttctttaggatggggcaagcctcattatgatggaggacttgaaatcactggc
tatatcgtagagcatcaaaaagtaggagatgaggcctggataaaagatacaacaggaact
ggtgtccgaatcactcaatttgttgtccctgatcttcagactaaagaaaaatacaatttt
agaatcagagccatcaacgatgcaggtatcggggagccagcaataattccagatgttgaa
attatagaacgggaaatggctcctgattttgaactagatgccgagcttcgaagaacactt
gttgttagagcgggactcagtattagaatattcgtgcccattaaaggtcgtcctgctcct
gaagtgacatggaccaaagatgacatcaaccttaaaaaccgagctaacattgaaaacacg
gaatcatttactcttctgattataccagaatgtaacagatatgacactggtaaatttgtc
atgaccattgaaaaccctgttgggaagaaaagtggctttgttaatgtcagagtcctggat
accccaggacctgtccttaacctgaggcctacagacatcacaaaggacagcgtcaccctg
cactgggacctccctctgatagatgggggctcccgtataacaaactacattgtggagaaa
cgagaagcaacacggaaatcttattccacagtcaccacgaagtgccataaatgcacatat
aaagttactggcctgtcagaaggatgtgaatacttcttcagagtgatggcagaaaacgaa
tatggaattggtgagccagcagaaacaacagaacctgtgaaggcctcagaagcaccatcc
ccaccagatagtctgaacattatggacataactaggagcacagtcagcctggcatggcct
aaaccaaagcacgatggtggcagtaagatcactggctatgtgatcgaagcccaaagaaaa
ggctctgaccaatggacccatgtcaccacagtgaaggggttagaatgtgtcgtgaagaat
ctaaccgaaggggaagaatacaccttccaggtgatggcagtgaacagtgcaggaagaagt
gcccctagagaaagcagacccgtcattgtcaaggagcaaaccatgcttccagaactggat
cttcgtggcatttatcagaaactagtcatcgccagagctggtgagaacatcaaagtggaa
attccagtgcttggtcggccaaagcccacagttacgtggaaaaaaggagaccagattctt
aaacagacacagagagttaattttgaaaatacagccacttcaaccatcttaaatatcaac
gagtgtgtaagaagcgatagcgggccctatccattaacagcaaggaacattgtaggagag
gttggtgatgtcatcaccattcaagtccacgatatcccagggccacctactggaccaatc
aaattcgatgaagtttcatctgattttgtaaccttctcttgggacccacctgagaacgat
ggaggtgtaccaataagcaactacgtagtagaaatgcggcagacagacagtactacatgg
gttgaattagcaaccactgtcatacgcactacctataaagccactcgccttactaccgga
gtggagtatcaattccgggtaaaagctcaaaatagatatggagtgggaccaggcatcaca
tccgcatctatagttgccaactatccatttaaggttcctgggcctcctgggacccctcag
gtgactgcagttaccaaggattcaatgacaattagctggcatgagcctcttactgatggt
ggaagccccattttaggataccacgttgaaagaaaagaacgaaatggtattctctggcag
actgtgagcaaagcattagtaccaggcaacattttcaaatcaagtggacttacagatggt
attgcttatgaattccgagtgattgcagaaaacatggcagggaaaagcaagccgagcaag
ccatctgaacctatgcttgctttagatcccattgacccacctgggaaaccaattcctcta
aatattactagacacacagtgacacttaaatgggctaagcctgaatacactggaggcttt
aaaattaccagttatatagttgaaaagagagaccttcccaatgggcggtggctgaaggcc
aacttcagcaacattctggagaatgaatttacggtcagcggcctaacagaagatgctgcc
tacgaattccgtgtgattgccaaaaatgctgctggtgctattagtccaccatctgagcca
tcagatgctatcacgtgcagggatgacgttgaagcaccaaggataatggtggatgttaaa
tttaaagacacagtaatactaaaagcaggtgaagcattcaagctagaagctgatgtttca
ggtcgcccaccaccaacaatggaatggacaaaagatggaaaggagcttgaaggcacagca
aagttagaaataagaattgcagatttctctacttacctgataaacaaggattcatcaaga
agggacagtggtgcttatatccttacagcaacgaatcctggtgggtttgctaaacacatt
ttcaatgtcaaagttcttgatagaccaggcccacctgaaggacctttagctgtatctgaa
gtgacatcagaaaaatgtgtgttgtcatggttgcctccactggatgatggaggtgccaaa
attgattactatatagttcagaaacgtgaaaccagcagattggcatggacaaatgtagcc
tcagaagtccaagtgacaaaactaaaggtcactaaacttctgaaaggcaatgaatacata
ttccgcgtaatggctgtaaataaatatggagttggagagccactggaatcagagcccgtg
cttgcagtaaatccttatggaccccctgatccacccaaaaaccctgaagttacagctatt
actaaagattcgatggttgtctgctggggacatcctgactctgatggtggaagtgaaatc
atcaattatattgtagaacggcgcgataaagctgggcaacgctgggtgaaatgtaacaag
aaaactcttactgatctaagatataaagtgtctggactgacagaaggacatgaatatgag
ttcaggattatggctgaaaatgctgctggaattagtgcaccaagttctaccagtccattt
tataaagcttgtgatgctgtgtttaagcctggcccaccaggtaacccacgtgttctagat
tcgagcagatcatccatttcaattgcttggaataagcctatctacgatggcggttcagaa
atcactgggtatattgttgagattgccctgccagaggaggatgaatggcagattgtcact
ccaccagctggactcaaggcaacctcttataccatcaccaacctcatagagaatcaggaa
tataaaatccgcatctatgccatgaattctgaaggaatgggagaacctgcacttgttcct
ggaactccaaaggctgaagagaggatgctgcctccagagattgaactggatgctgacctg
cgtaaagttgttactataagagcttgctgtaccctgagactttttgttccaatcaaagga
aggcctgcacctgaggtgaagtggacccgggaacacggagaatccttagataaagctagc
attgaatccacaagctcttacaccttgcttattgttggaaatgtaaacagattcgacagt
ggcaaatacatactaactattgaaaacagctcaggcagcaagtccgcgtttgtcaatgtt
agagtactagacacaccaggccctccacaggatctcaaggtaaaggaggtcactaagtca
tctgtcacattgacatgggagcctcctctccttgatggaggttcaaaaataaagaactat
attgttgaaaagagggaatcaacaagaaaagcatattcaactgttgcaacaaactgccat
aagacgtcctggaaggtagaccagcttcaagaaggctgtagttactacttcagggttctt
gctgaaaatgaatatggcattgggttgcccgctgaaactgcggagtctgtgaaagcatca
gaacgaccccttcctccaggaaaaataactttggtggatgtcaccagaaatagtgtgtca
ctctcttgggaaaaaccagaacatgatggaggcagccgaattctaggctacattgttgag
atgcagagcaaaggtagtgacaaatgggccacatgtgccacagtcaaagtcactgaagcc
actataaccggattaattcagggtgaagaatactctttccgtgtttcggctcagaatgaa
aagggcatcagtgatcctagacaactgagtgtgccagtaattgccaaagatcttgtcatt
ccaccagccttcaaactcctgttcaatactttcactgtactggcaggtgaagacctaaaa
gttgatgttccattcattggacgccctacacctgctgtaacctggcataaagatgacgta
cccctgaagcagacaactagagtaaatgcggagagcacagaaaatagtacactattgaca
ataaaggaagcctgccgagaagatgttggacattacacagttaaactaactaactcggct
ggtgaagctactgaaacccttaacattattgttcttgacaaaccagggcctccaactgga
ccagttaaaatggaggaagtgacagctgatagtattactctttcctggggcccacctaag
tatgatggtgggagttctatcaataattacattgtagaaaaacgggacacttccacaacc
acctggcatattgtgtcagcgactgttgcaaggacaacaataaaggcttgcagattaaag
actggatgtgagtatcagtttaggattgcagctgaaaacagatatggaaagagcacctac
ctcaattcggagcctgtcatagcccagtatccattcaaagttcctggtcctcctggcaca
ccatttgtaatgctctcctccaaggacagcatggaggtacactggaatgagccagttagt
gatgggggtagcaaagtcattggctatcatctggaacgcaaggaaagaaacagtatcctc
tgggtgaagttgaataaaacacccattcctcaaaccaagtttaaaacgactggcctcgat
gaaggcattgaatatgaatttagagtcactgcagagaacatcgtgggcatcggcaagcca
agtaaggtgtcagaatgctatatggctcgtgacccatgtgatccaccagggcggccagaa
gcaattattgtcacacgaaattccgtgactctccagtggaagaaacctacttatgatggt
ggaagcaagatcaccggctatattgtagagaagaaagaattgcctgaggggcgctggatg
aaagccagttttacaaatgtcatcgacactcagtttgaagtaactggcctagttgaagat
catagatatgagttccgggtaatagctcgaaatgctgcaggagtgtttagtgagccttca
gaaagcacaggagcaataacagcaagagacgaggtagagccaccacgaataagtatggat
ccaaaatacaaagacacaattgtagttcatgctggtgagtcattcaagattgatgcagat
gttcatggcaaaccaataccgaccattcagtgggtaaaaggtgatcaggagctttcaaat
acagcccgattagaaataaagagcactgactttgccacgagtctcagtgtaaaggaagca
gtacgcattgacagtggaaattacatactgaaggccaaaaatgttgcaggggagagatca
gttactataaatgtcaaagttcttgatagaccaggaccacctgagggacctgttctagta
tcaggagtgacagcagaaaaatgcacagtagcttggaaacccccactacaggatggtggg
agtgacatcataaattatattgtggagaggagagaaaccagccgcttagtttggactctg
gttgatgccaatgtgcaaactctcagctgcaaggttactaagcttctcgaaggcaatgaa
tatattttccgtataatggctgtaaacaaatatggtgttggtgaaccacttgaatctgag
ccagtgattgccaagaatccatttgtagtgccagatgcaccaaaggccccagaaatcaca
acagtgaccaaggactcaatgattgttgtatgggaaagaccagaatctgatggtggcagt
gaaattcttggatatgttcttgaaaaacgcgataaggagggcattagatggacaagatgc
cacaaacgcctgattggggaattgcgcttgagagtaactggactcctagaaaatcacaat
tatgaattcagagtctcagccgagaatgctgctggacttagtgaaccaagcctgccttct
ggttaccaaaaggcttgtgatcctatttataaaccaggacctccaaacaatcccaaagtc
atagatattaccagatcttctgtcttcctttcttggagcaaaccaatatatgatggtggc
tgtgaaatccaaggctacattgttgaaaaatgtgacgtgagtgttggtgaatggaccatg
tgcactccaccaactggaatcaataaaacaaacatagaagtagaaaagctgttggaaaag
catgaatacaatttccgtatctgtgctgttaataaagctggagttggagaacatgctgat
gtccctggacctgttatagttgaagaaaaattagaagcaccagacattgaacttgaccta
gaactaagaaaaattataaatataagggcaggtggctccttaaggctctttgtccctatt
aaaggtcgtcctacaccagaagttaaatgggggaagatggatggtgaaatccgagaggca
gctataattgatgtcactagcagtttcacctctcttgttcttgacaatgtcaaccgctac
gatagtggaaaatatacgctcacattagaaaacagcagtggaacgaagtctgcctttgtt
accgtgagagtcctggacacaccaagtccgcctgttaacctgaaagtcacagaaatcaca
aaagactcagtatcaattacgtgggaacctcctctgttggatgggggatccaaaataaaa
aattacattgttgagaaacgtgaagccacaagaaaatcatatgctgcagtggtaacaaac
tgccataagaattcttggaagattgagcaactccaggaaggctgcagttattactttaga
gtcacagctgagaacgagtacggtcttggccttcccgcccacactgctgatcctattaag
gttgcagaagtcccacaacccccaggaaaaataactgtggatgatgttaccagaaacagt
gtttccttgagttggacaaagcctgaacatgatggtggcagtaaaatcattcagtacatt
gtggaaatgcaagctaaacacagcgagaaatggtcagagtgtgctcgagtcaagtccctt
gaagcagtaattactaacctaactcagggagaagagtatctctttagagttgttgctgtg
aatgaaaagggaagaagtgatcctaggtcccttgcagttccaatagttgccaaagatctg
gtcattgagccagatgtaagacctgcattcaacaattacagtgtacaggtcggccaagat
ttgaaaatagaagtgccaatttctggacgtcctaagccaactgttacctggactaaagat
ggtcttccactgaagcagaccacaagagtcaatgttactgattcacttgacctcactgta
ctcagcattaaagaaactcataaggatgatggtggacattatggaatcacagtggctaat
gttgtaggtcagaaaacagcatccattgaaattataactctagataaacctgatcctcca
aaaggacctgttaaatttgatgaagtcagtgctgaaagtattactttatcttggaatccc
ccattatatacagggggctgccagatcaccaactacatagttcagaaaagagatacaacc
accacagtatgggatactgtttctgctactgttgccagaaccacgctcaaagtgaccaaa
ctgaaaactggtacagaataccaattcagaatatttgctgaaaacagatatggacaaagc
tttgctttggagtctgatccaattgtagctcaatatccctacaaagaaccaggccctcca
ggcacaccatttgtcacagccatttccaaagactccatggtcgttcagtggcatgaacca
atcaataacggtggaagcccagtcataggttaccaccttgagagaaaggaaagaaatagt
atattgtggacaaaagtcaacaaaactattattcatgacactcagtttaaagcagtcaat
cttgaagagggcattgaatatgaattcagagtttatgctgaaaatattgttggtgtaggt
aaagcaagcaagaattccgaatgctacgtagctagagatccctgtgacccaccaggaacc
ccagaagcaataatggttaaaagaaatgaaatcactttacagtggaccaaacctgcttat
gatggtggaagtatgattacaggttacattgtagagaaacgtgatttgcctgagggtcgc
tggatgaaggccagcttcacaaatgtcattgaaactcaattcactgtgtctggtcttact
gaagatcaaagatatgagttcagagtcattgcaaagaatgcggctggtacaataagtaaa
ccctctgacagtactggaccaataactgccagggatgaggttgaacttccaagaatttca
atggatccaaaattcagagacacaattgtggtaaatgctggagaaacgttcaggcttgag
gctgatgtccacggaaagccccttccgaccattgagtggttacgaggagataaggaaatt
gaagaatctgccagatgtgaaataaagaacacagatttcaaggctttacttattgtaaaa
gatgccattagaattgatggtggacagtatattttaagagcttccaatgttgcaggttct
aagtcattcccagtaaatgtaaaagtattggatagaccaggtcctccagaaggtccagtc
caggttaccggagtcacttctgaaaaatgcactttaacatggtctccaccacttcaagat
ggtggcagtgatatttctcactatgtcgttgaaaagagagaaacaagtcgacttgcctgg
actgttgttgcttcagaagttgtgaccgattctctgaaagttactaaactcttagaaggg
aatgaatatattttccgcataatggctgtcaacaaatatggagttggagagcctttggaa
tctgcaccagtactaatgaaaaatccatttgtgcttcctggaccaccaaaaagcctggaa
gtcaccaacattgccaaggactctatgactgtctgttggaaccgtccagatagtgatggt
ggaagtgagattattggttacattgtggagaaaagagatagaagtggcattaggtggata
aaatgtaataaacgccgcattacagatttgcgtctaagagtaacaggattaacagaagat
catgagtatgaattcagagtctctgcagaaaatgctgctggggttggagaaccaagtcca
gctacagtttattataaagcttgtgatcctgtattcaaacctggaccacccaccaatgca
cacattgtagacaccactaaaaattcaatcacacttgcctggggaaagcccatctatgat
ggtggcagtgagatccttggatatgtagtagaaatatgtaaagcagatgaagaagaatgg
caaatagttactccacagactggcctgagagccactcgatttgaaatttcaaaactcact
gagcaccaagagtataaaatacgagtctctgccctcaataaagctggcttaggtgaggct
acatcagttcctggtactgtgaaaccagaagataaacttgaagcacctgaacttgatctt
gactctgaattaaggaaaggaatagttgtaagagctggtggatctgccagaattcacatt
ccattcaaaggtcgcccaacacctgagatcacctggtctcgagaggaaggtgaattcaca
gataaggtccaaattgaaaagggggtaaactatacccaactatcaatagataactgtgat
agaaatgatgctggaaaatacactctcaagctggaaaacagcagtggatctaaatctgct
ttcgtaactgtgaaagttcttgacaccccaggactgccacaaaatttggcagtcaaagaa
gtgaaaaaagattctgtcctgctggtatgggaaccacccatcattgatgggggttcaaag
gtgaagaactatgttatcgacaaacgtgagtcaaccagaaaagcatacgctaacgtgagt
agcaaatgcagcaaaaccagctttaaagttgagaatcttacagaaggagccatttattac
tttagagttatggctgaaaatgaatttggagttggtgttccagtggaaaccgttgatgct
gtgaaagctgctgaacctccttccccaccaggaaaagtgacactcactgatgtgtcccag
accagtgcatcgctgatgtgggagaaacctgaacatgacggtggcagcagagtcttgggt
tatgttgttgaaatgcagcccaaaggaacagaaaaatggagtgttgtggccgaatccaaa
gtctgcaatgcagtggttactggtttgagttctggacaagaatatcagttccgcgtcaag
gcttacaacgagaaaggaaaaagtgatccaagagtgcttggtgttcctgtaatagccaag
gacttgaccatacagcctagttttaagttaccatttaacacatatactgtccaagctgga
gaagatcttaaaattgaaattccagttatcggccgaccaagacctaacatttcatgggtc
aaagatggtgagcctcttaaacagacaacaagagtaaatgttgaggaaacagctacctca
acgattctgcacattaaagaaagtaacaaagatgactttggaaaatacactataacagca
acaaatagtgcgggtacggcaacagaaaatctcagcatcattgttttggaaaagcctgga
cctccaattggaccagttcggttggacgaagttagtgcagactttgtggtcatctcttgg
gaacctcctgcctatactggcggctgccagataagcaactacattgtagagaagcgagat
acaactaccaccacttggcacatggtctcagcaacagttgcgagaacaacaattaaagta
accaaactgaaaacaggcactgagtaccagtttagaatttttgcagaaaacaggtatgga
aagagtgcccctctggattccaaaccagttattgtacaatatccatttaaagaacctgga
ccacctggaactccttttgtgacatccatttcaaaagatcagatgattgtgcagtggcat
gagccagttcatgatggaggaagcaaagttattggctaccatcttgaacagaaagaaaag
aacagcattttatgggtcaaattgaataagactcccattcaagacaccaaattcaaaaca
actgggcttgatgaaggccttgagtatgagttcaaagtttctgctgaaaatattgttggc
attggcaagcctagcaaagtgtcagaatgctttgttgctcgtgatccatgtgacccacct
ggtcgccctgaagccattgtcatcacaagaaacaatgttacactgaaatggaagaaacct
gcctacgatggtggtagcaagataacaggttatattgtagaaaagaaagatctacctgat
ggacgctggatgaaagccagctttaccaatgtattagaaactgaatttacagtgagtgga
cttgtggaagaccaaagatatgaatttagagtaattgcaagaaatgcagctggcaacttc
agtgaaccatctgaaagcactggtgccattactgccagagatgaaattgatgcaccaaat
gcctccctggatccaaaatataaagacgtaatcgttgttcgtgcaggagagactttcgtg
cttgaagctgatatccgcggcaagcctatacctgatattgtttggtcaaaagatggaaaa
gagcttgaagagacaactgctaggatggaaattaaatctactattcagaaaaccactctt
gttgtcaaagactgtatacgtactgatggaggacagtatattctgaaactcagcaacgtt
ggtggtacaaagtccataccaatcactgtaaaggtacttgacaggccagggccccctgaa
ggacctctaaaagtttctggtgttactgctgagaaatgttacctggcatggaacccacct
ttacaggacggtggtgctaatatttcacattacatcattgaaaagagagaaacaagtaga
ctctcctggacccaggtttcaactgaggtacaggcccttaactacaaagtcactaaactt
cttcctggtaatgagtacattttccgtgtcatggctgtgaataaatatggaattggagag
cccttggaatctgagcctgttatagcctgtaatccgtataagccaccaggtcctccttca
tcccctgaagcctcagcaatcgccaaagattctatggtagtaacatgggcacgcccggtg
gatgatggaggtgccgaaattgagggctacattcttgaaaaacgagataaggaaggcatt
agatggaccaagtgcaacaagaaaactctaacagatctccgattcagagtaactggcctt
accgaaggtcattcctatgagttcagagtcactgccgaaaatgcagctggtgtgggtgaa
cctagcgagccatctgttttctatcgtgcatgtgatgccttgtatccaccaggtccacca
agtaatccaaaagtgacagacacttccagatcttctgtctccctggcatggagtaagcca
atttatgacggtggtgcacctgttaagggctatatggtggaggtcaaagaagccgctgct
gatgaatggacaacctgcactccaccgacaggattacaaggaaagcagttcacagtgacc
aaactaaaagaaaatactgagtataacttccgtatttgtgccatcaattctgaaggtgta
ggtgaacctgcaactatacctggctcagttgttgctaaagagaggctagagccaccagaa
atagaacttgatgctgatctcagaaaggtggtcgttctgcgggcaagtgctactttacgc
ttatttgtcacaatcaaaggtcgaccagaacctgaagttaaatgggaaaaggctgaaggc
actctcacagagagggcccagatcgaggtaaccagctcctacacaatgttggtaattgat
aacgttaccagatttgatagcggtcggtataatctgacactagagaataacagcggctcc
aaaacagcttttgttaacgtcagagttcttgactcgccaagtgcccctgtgaatttaaat
gtaagagaaataaagaaagactcggtgacattgtcttgggagccaccacttattgatggt
ggagctaagattacaaactacattgttgaaaaacgagaaactacaagaaaagcatatgct
actgttacaaacaattgcacgaagaatacttttaaaattgaaaatctacaagagggatgt
tcttactacttccgagtcttggcttccaatgaatacgggattggtttgccagctgaaacg
actgaacccgttaaagtttctgaaccacccctcccacccggaagagtgactcttgttgat
gtgactcgtaacacagctacaattaagtgggagaagccagaaagtgatggtggcagcaaa
attactggttatgtagttgaaatgcagactaaagggagtgaaaaatggagcacttgcaca
caagttaagactctagaagcgactatatctggcctaactgcgggagaagagtataccttc
agggtagctgcagtcaatgaaaagggaagaagtgatccaagacaacttggagtgccagta
attgcaagagatattgaaataaagccctccatcgagcttcctttcaatactttcaatgta
aaggctagggaccaacttaagattgatattccatttaaaggaagacctcaagctactgta
agctggaaaaaggatggtcagattcttaaagaaaccacaagggtcaatgtttcttcttca
aagactgtaacatcactatctattaaggaagcttccagggaagatgttggaacttatgaa
ttgtgtgtttcaaacagtgctggatccataacagttcctataactgtaattgtcctcgac
aaaccagggcctccaggacctgttcatattgatgaagttagctgtgacaatgtaacaatt
tcctggagtcctccagaatatgacggtggctgccaaattagcaattacatcgtcgaaaag
agagaaaccacttctaccacatggcacgtagtttcacaggcagttgcaagaacatccatt
aaaatagttcgtctgacaacaggaagtgagtatcagttccgtgtttgtgcagaaaaccgc
tatggcaagagctcctacagtgaatctaaacctgttgttgcagagtatccattcagccct
ccaggtcctcctggcactcctaaagttgtgcatgccacaaaatctaccatgattgtaagc
tggcaagtgccagttaatgatggaggaagtcgagtaattggctatcaccttgaatataaa
gagagaagcagcattctttggtcaaaagcaaataaaatcctcatcgctgatacacaaatg
aaagtctctggccttgatgaaggactgatgtatgaatatcgtgtatatgctgagaacatt
gctggaattggtaaatgcagtaaatcttgtgaaccagtccctgcaagagatccctgtgac
cctcctggacaacctgaagtcacaaatatcacaagaaaatcagtgtcgcttaaatggtct
aaaccacattacgatggtggagctaagatcacaggatacattatcgaacgtagagaacta
ccagatggccgatggctgaagtgcaattttactaacgtacaagaaacatactttgaagta
accgaacttactgaagatcagcgttatgaattccgggtttttgcaaagaatgcagctgac
tcagttagtgaaccatctgaatccactgggcctattacagttaaagacgatgttgaggct
ccaagaattatgatggatgtcaagttccgagatgttattgttgtcaaagctggagaggtc
cttaagataaatgcagacatcgcagggcgacctctgccggtaatttcctgggccaaggat
ggggtagaaattgaagaaagagcaagaacagaaattgtctcgacagactacaatacttcg
ttaacagtgaaagactgcatccgacgagacactggtcagtatgtactaacactgaagaat
gttgcaggaactcggtctatggcagttaactgcaaggtacttgataagcctggcccacca
gcaggaccacttgaaataagtggcctcacagctgagaaatgctcactttcctggggaccg
ccccaagaaaatggtggtgcagatatcgactattacattgtagaaaaacgtgaaacaagc
cacctcgcatggacaatatgtgaaggagaattaaggacaacatcctgtaaagtaaccaag
ttactcaaaggcaacgaatacatctttagagtaacaggtgttaataaatatggtgttggt
gagcccctagagagcgtggcagtaaaagcactagacccatttacagttccaagtccaccc
acatctctggaaattacatctgtgaccaaagagtccatgaccctttgctggtcaagacca
gagagtgatggaggcagtgaaatctctggatatataattgaaaggcgagagaaaaacagc
ctacgatgggtgcgtgtaaacaaaaaaccagtttatgacctgagagtgaaatcaactgga
cttcgggaaggatgtgaatatgagtaccgagtttatgcagaaaatgctgctggcctgagc
cttccaagtgaaacttctcccttaattcgggcagaagatccagtattcttgccatctcct
ccatccaaacccaaaattgtggactcaggcaagacaaatataactattagctgggttaag
cccttgtttgatggtggggccccagtaactggatacactgtagaatataagaaatctgat
gaaactgagtgggagactgccattcagaacttaagaggcacagaatataccataggcgga
ctaacaacaggagccgagtatgtgttcagagtaaggtctatcaataaggtcggtgctagt
gatcccagtgatagctctgatccccaagtagcaaaagaaagagaagaagaacctgtattt
gatcttgacagtgaaatgaagaagaccttgattgtcaaggccggtgcctcatttaccatg
accgtacctttccggggaagaccagcacctagtgtcttgtggagtaagccagacagtgac
ctccgcactagagcttatattgattccacagactctcgtacgtcacttactattgaaaat
gccaacagaaatgattctggaaaatacacagtaacaattcagaatactgtgaatgctgct
tcactgaccttagttgtcaaagttttagattctcctggtcctccaaccaatattactgta
catgatataaccaaagagtctgcagtgttatcctgggatgttcctgaaaatgatggtgga
gcaccagtgaagaattaccacatagaaaaacgtgaggccagtaagaaagcatgggtctct
gtgaccaacaactgtaaccgcctctcctacaaaatcaccaacttacaagaaggggcaatt
tactacttccgagtttctggagagaatgagtttggtgttggtgtaccagctgaaacaaag
gaaggagtaaaaataacagaaaaaccaagcccacccgaaaaacttggagtaacaggtgta
tccagagatagtgtttccctgacctggttgaagccagaacacgatggtggaagcagaatt
gtacactatgtcattgaagcattagaaaaggggcagaaaaattgggttagatgtgcagtg
gtaaagtcaacccaccacattgtttctggtctgagggagaattctgaatactttttccgg
gtgtttgctgaaaatcaagctggtctgagcgacccaagagagctcctgcttcctgttctt
attaaagaacaactagaaccacctgaaattgatatgaagaatttcccaagtcatactgtg
tatgtgagagctggttcaaaccttaaagttgacattccaatttctggaaaaccattgccc
aaagtgaccttatcaagagacggtgtccccctgaaggcaaccatgagatttaatactgaa
gttactgctgagaacctgaccatcaatctcaaagaaagcgttaccactgatgctggaaga
tacgagatcactgctgccaactccagtggaacaaccaaagctttcattaacattattgta
ctggacaggcctggtcccccaactggccctgttgttattagcgatataacagaagaaagt
gtgactctcaaatgggagccgccaaagtatgatggcggaagtcaagttactaactacatt
gtactcaagagagagacgagtactgcagtgtggactgaagtatctacaacagttgcaaga
accacgattaaaatcatgaaactgaccacaggagaagaataccaattccgaatcaaggca
gaaaaccgctttggcatcagtgatcacatagattcagcatgtgtggttgtcaaactacca
tacacaacacctggaccaccatctacaccatgggtcactaatgttactcgagaaagcatc
accgtgggctggcatgaaccagtgtccaatggaggcagtccagttataggctatcacctg
gaaatgaaagacagaaacagtattttatggcaaaaagccaacaaattggtcatccgtaca
actcacttcaaagttacaacaatcagtgctggacttatttatgaattcagggtatacgca
gaaaatgctgctggtattggaaaacccagccatccttctgaaccagtcctagccattgat
gcctgtgagcctccaagaaatgtccgtatcactgatatttcaaagaactctgtcagcctt
tcatggcaacaaccagctttcgatggaggaagcaagattacaggctacattgttgagaga
cgagaccttccggatggcagatggaccaaggccagcttcaccaatgttatcgagactcaa
ttcatcgtctctggcttgactcagaattcccagtatgaattccgtgtctttgctaggaat
gctgttggttcagtcagcaatccatctgaggttgtaggccccattacgtgcattgattct
tatggtggacccgtaattgatttgcctctagaatatacagaagtcgtcaaatacagagca
ggtacatctgtgaagctcagagctggcatttctggcaaacccgagcctacgattgagtgg
tataaagatgataaagagttacaaaccaacgcactggtatgtgttgaaaataccaccgac
cttgcgtctatactcatcaaagatgcaagtcgccttaatagtggaagctatgaactaaaa
ctaaggaacgccatgggttcagcctcagccaccatcagagtacagatcctggacaaacca
ggacctcctggtggtcccattgaatttaagacggtcactgctgaaaaaataacccttctc
tggcgccctcccgcggatgatggtggtgcaaaaattactcactacatcgtggaaaaacgt
gagacaagccgtgtagtatggtctattgtgtctgaaaatttggaagaatgcatcataacc
accaccaaaattatcaaaggaaatgaatacatcttccgggttcgagccgtgaacaaatac
ggaattggtgatccgctggaatccgatccagtggtagcaaagaatgcctttgttacccct
gggcctccaggcgtaccggaggtgaccaagattaccaagaattcaatgactgttgtctgg
agcaggccagttgtcgatggtggtagtgaagtaagcggctatttccttgagaaaagagac
aagaagagtctaggatggtttaaggtctcaaagaagactatccgtgacaccagagagaaa
gtgactggattaacagaaaacagtgactaccaataccgagtctgcgctgtaaatgctgct
ggtcagggtccattctctgaaccatctgacttctacaaagctgctgatcccattgaccct
ccaggcccaccagctaagataagaatcgcagattcaaccaaatcctccatcactcttggc
tggagtaaacccgtctatgacggaggcagtgctgttactggatatgttgtcgccatgagg
caaggagaggaagaggaatggacggttgtctctaccaagggagaggtcagaactacagaa
tatgtggtatccaacctgacacctggagtcaactactacttccgggtatctgctgtaaac
tgtgccggaccaggagaacctatagaaatgactgaagctgtacaagctaaagatatactt
gaggaaccagagattgacctagatgtggctctcagaacctctgttatagctaaagctggt
gaagatgtacaagtgctgattcccttcaaaggcagacctccacctactgtcatatggaga
aaagatgagaagaatctcagcagtgatgccagatataacattcaaaacaccgattcatct
tcattactcatgattcctcaagtcactcgcaatgacacaggaaaatatattctcacaata
gaaaatggcattggtcaaccaaagtcttcaactgtgagtgttaaagtgcttgatacacca
gccacctgccagaaactacaggtgaaacatgtttctcaaggcacagtcactttgttctgg
gatcctcctctcattgatggaggatctcccataattaattacgtcattgaaaagagagat
gccaccaagagaacatggtcttcagtatcacacaaatgtaccagtacatcctttaagata
acagatttgtcagagaaaactccattcttcttcagagttcttgcagaaaatgaaattgga
attggggaaccctgtgaaactacagagccagtgaaggctgctgaagtcccagctcctata
cgtgatctgtcagtgaaagactcaacaaaaacatctgttaccctgagctggaccaagcct
gactttgatggtggtagcgtcatcacagaatacgttgtggaaaggaaaggtaaaggtgaa
caaacatggtcacatgctggtgtaagtaagacctgtgaaattgaagttagccaacttaag
gaacagtcagtcctggaattcagagtgtctgccaaaaatgacaaaggactgagtgatgct
gtcactattgggccaattacagtgaaagaacttgtgattacacctgaagttgacctgtca
gatatccctggggcacaagtcgctgtgagaattgggcataatgtgcacctcgaattacct
tataaaggaaaacccaaaccatctatcagttggctgaaagatggtttgccattgaaagaa
accgagtatgttcgtttcagtaaaaccgaaaacaaaattactttgagtattaagaatgtc
aagaaggagaacggagggaaatacacccttattcttgataatgcagtttgcagaaactca
tatcccattacgatcatcacacttggcccaccgtcaaagcccaaagggcccattcaattt
gatgaaatcaaggctgacagtgtcatcatgtcatgggatgtgcccgaagatgatggagga
ggagaaattacctgttacagcattgagaagcgggaagcttcacaagctaattggaagatg
gtgtgttcaagtgttgccaggacaactttcaaagttcctaatctagtcaaagatgctgag
taccagtttagggttagggcggaaaacagatacggagtcagccagccacttgtctcaaac
atcattgtggcaaaacaccagttcaggattcctggccccccaggaaagccagttgtatac
aatgtgacttccgatggcatgtcactaacttgggatgctccagtttatgacggtggttcg
gaagttactggattccatgttgaaaagaaagaaagaaatagcatcctctggcaaagagtt
aacacatcgccaatatctggaagagaatacagagctaccggactaatggaaggcctagat
taccagttccgtgtatatgctgaaaattctgctggcctaagcgcgcccagtgacccaagc
aaatttactttagctgtttctccagtagacccacctggcactcctgactacattgatgtc
acccgggaaaccatcacacttaaatggaacccaccactgcgtgatggaggcagtaagatc
gtggcctacagcattgagaaacggcaagggagcgatcgttgggtcagatgcaactttact
gatgtcagtgaatgtcagtacacagtcacaggacttagtcccggggaccgatatgagttc
agaataattgcaagaaatgctgtcggtactataagtccaccctcacagtcttctggcgtt
atcatgacgagagacgaaaacgttctaccaactgttgagtttggccctgagtactttgat
ggtctcattattaagtctggagagagccttagaattaaagctttggtgcagggacggcca
gtacctcgagtaacttggttcagagatggagtagaaattgaaaagaagatgaatatggaa
ataactgatgtcctaggatccaccagccttttcgttagagatgctacccgggaccatcgt
ggtgtatatagcgtggaagccaaaaatgcatctggctcctcaaaagcagaaatcacagtg
aaagtacaagatacaccaggaaaagtagttgggccaataagattcaccaatattactggc
gagaagatgacgctatggtgggatgctcctctcaatgacggctgtgctcccattactcac
tacatcattgaaaaacgggaaaccagcagacttgcttgggcactgattgaggataactgt
caagcccacagctatactgccactaaactaataaatggcaatgaataccagttccgtgtt
tctgcagttaacaagtttggtgttgggaggccacttgattctgacccagtggttgctcaa
atacaatacactgttcccgatgcccctggcactccagaacctagcaatgtaacaggcaat
agcattaccctgacatgggcaaggccagagtcagatggtggcaatgaaattcaacaatat
atccttgaaaggagagaaaagaaaagcacacgatgggtaaaagtaatcagcaaacgacca
atctctgagacaagattcaaagtcactggtctgacagaggggaatgagtatgaattccac
gtcatggctgaaaatgctgcaggaataggacctgcaagtggtatctcaagactaatcaaa
tgtagagagccagtcagcccaccaagtgctcccgctgtggtcaaagtgacagacacatcc
aagacaactgtgagcttagaatggtctaagccagtgtttgatggcggcatggaaataatt
ggctatattattgaaatgtgcaaagctgacttaggagactggcacaaggtaaatgcagaa
gcatgtgtgaaaacaagatatacagtcactgatctacaagcaggtgaagaatacaaattc
cgggttagtgctatcaatggtgctggaaaaggagagagcagtgaagtgactggcgcaatt
aaagcagttgaccgattagcagctcctgagttagatatcgatgcaaacttcaagcagacc
catgttgttagagctggggccagtattcgcctcttcattgcctaccaaggtagacctact
cctacggctgtgtggaccaaacctgactccaacctcagcattcgggctgatatccacaca
acagactccttcagcaccctcactgtggaaaactgcaacaggaatgatgcagggaaatac
acccttaccgtagaaaacaacagtggcagtaagtcaatcacattcactgtaaaggtgcta
gacactccaggcccacctggcccaatcactttcaaggatgtgacccgcggatctgttaca
ctgatgtgggatgctcctatccttgatggtggtgcccgaatccatcattatgtggtagaa
aaacgagaagccagtcgtcgtagctggcaggctatcagtgaaaaatgcactcgtcagatc
ctcaaggtcagtgacctggcagaaggtgtcccatactatttccgtgtttctgcagaaaat
gagtacggtgtgggtgaaccctatgaaatgccagaaccaatcgtagccacagaacagcct
gctccacctaagagacttgatatcattgacacaagcaactcctctgcagtcttagcttgg
cttaaacctgaccatgatggaggcagccggatcactggctaccttctcgaaatgagacaa
aagggatctgacttctgggttgaggctggtcgcaccaaacagatgactttcacagtggag
cgcttggttgagaacactgaatatgaattccgtgtgaaggccaagaatgatgctggctat
agtgaacccagggaagccttttcttccgtcatcatcaaggaacctcaaattgagcccact
gctgatctcactggaattactaatcagctcataacttgcaaagcaggaagcacatttacc
attgatgtcccaatcactggtcgtcccgctcccaaagtaacatggaagcttgaagaaatg
agacttaaggagacagatcgagtgagtatcataacaacaaaagacagaaccaccctgtct
gtaaaggatagcatgagaggtgactctggaagatacttcttgaccctggaaaacacagct
ggtgttaaaacatttaccatcaccgttgtggtcattggaaggccaggtcctgtaactggc
cccattgaggtctcatctgtctcagctgaatcatgtgtcctgtcatgggctgaacctaaa
gatgatggaggcactgacattactaattacatagttgaaaagcgtgaatcgggtacaaca
gcttggcagcttgtcaattccagtgtcaagcgcactcagattaaagtcactcatctcaca
aaatacatggaatattctttccgtgtcagttcagagaacagatttggtgtcagcaagcct
ctagaatcagcaccaataattgctgagcatccattcgtcccaccaagtgctcctaccaga
cctgaagtctaccatgtgtctgccaatgccatgtctattcgttgggaagaaccttatcat
gatggtggcagtaaaattattggctactgggttgagaagaaagaacggaacaccattctt
tgggtgaaagaaaacaaagtgccatgcttagagtgcaactacaaagtgagtggtttggtg
gaaggactagaataccaattcagaacatatgcactcaatgccgcaggtgttagcaaagcc
agtgaagcttcaagacctatgatggctcaaaacccagttgatccaccaggaagaccagag
gtgacagatgtcacgagatcaacagtgtcactgatttggtctgccccagtgtatgatggt
ggcagcaaggttgtgggctatatcatagagcgtaagccggtcagtgagattggagatggt
cgctggctaaagtgcaactataccattgtatctgacaatttcttcactgtgactgctctc
agtgaaggagacacttatgaattccgtgtgttggctaagaatgcagcgggagtaattagc
aaaggatcagaatctacaggccctgtcacctgcagagatgaatacgctccacccaaagct
gaactggatgccagattacagggtgatctggttaccatcagagcaggctcggatcttgtc
cttgatgctgcagttggtggcaaacctgaacccaaaattatctggaccaaaggggacaag
gaactagatctctgtgaaaaagtctctttgcagtatacaggcaaacgagcgactgctgtg
atcaagttctgtgacagaagtgatagcggaaaatacacgttaacagtgaagaatgccagt
gggaccaaggccgtgtctgtcatggtcaaagttcttgattcccctggcccatgtggaaac
ctcaccgtcagcagagtaacagaggaaaagtgcactttagcctggagccttcctcaggaa
gatggaggagcagaaataactcactacattgtggaaagacgagagactagcaggctcaac
tgggtgatcgttgaaggcgaatgtccaaccttgtcccatgtagttaccagactcatcaag
aacaatgaatacatattccgagtgcgggcagtgaacaaatatggccctggtgtgcctgtt
gaatcagagccaattgtagccagaaactctttcactattccatcacaaccgggcatacct
gaagaagttggggccggcaaagagcatatcatcattcagtggacaaaacctgaatctgat
ggtggcaatgagatcaacaactacctagtagacaaacgtgagaaaaagagcttgcgctgg
acacgtgtcaacaaagactatgtggtatatgatacaaggctgaaggtgactggcctcatg
gaaggttgtgattaccagttccgagtcactgcggtgaatgctgctggtaacagtgaaccc
agcgaagcttgcaactttatctcatgcagagaaccatcatatacccctggaccaccttct
gctccaagagttgtggataccaccaagtccagcattagtttggcatggaccaagcccatg
tatgatggtggcattgacatcctgggatatgttcttgaaatgcaagagaaggatactgat
cactggtaccgagtgcacaccaaggccacaataagaaataatgaattcactgtgccggac
cttaaaatgggccagaaatactccttcagggttgctgctgtgaatgcgaagggtatgagt
gaatacagcgagtcaactgctgaaattgagcccgtggaaagactagaaataccagaccta
gagcttgcagatgatttaaagaagactgtgaccatcagagctggggcctcattgcgcctg
atggtgtctgtatctggaagaccacctcccgtcatcacatggagcaagaagggcattgac
cttgcaaaccgggcaattattgacaccactgacagctactctttacttattgtggacaaa
gttaaccggtacgatgctggaaaatacaccattgaagccgaaaatcaatctggcaagaaa
tcagcaacagtccttgttaaagtatatgatactcctggtccctgtccttcagtgagagtt
aaagaagtatcgagagattctgtgaccattacctgggaagttcccacaattgatggtggg
gctcctgtcaacaattacattattgagaaacgtgaggctgccatgagagcattcaaaaca
gtaactaccaaatgcagcaagacactgtaccgaatttccggacttgtagaaggaaccatg
tactatttcagagtgttgccagaaaacatttacggcatcggggaaccctgtgaaacatct
gatgcggttctggtctcagaagtacctctggtgcctacaaagctagaagtggttgatgtc
accagatcaactgtcactctggcctgggaaaaaccactctatgatggtggtagccgactc
actggatatgttcttgaggcctgcaaagctggcactgagagatggatgaaggttgtcacc
ttaaaacccaccatcctagagcacactgtcatttccttaaatgaaggtgaacagtaccta
tttagagtaagggcgcaaaatgagaaaggagtgtcagaaccaagagagatcatcacagcc
gtgactgtacaagacctcagagtgttgccaacaattgatctttctacaatgcctcagaag
accattcatgtcccagctggcagaccagtggagctcgtgataccaatcgctggtcgccca
cctcctgctgcttcctggttctttgctggttctaaactaagagaatcagagcgtgtcaca
gttgaaactcatactaaagtagctaaattaaccatccgtgaaaccactatcagagatact
ggagaatatacacttgaattgaagaatgtaactggaactacttcagagaccattaaagtt
atcattcttgacaagcctggtcctccaactgggcctattaagattgatgaaattgatgct
gcttcaattaccatttcctgggaaccacccgaattagatggtggcgctccattgagcggt
tatgtggtagaacagcgtgatgcccatcgtccaggatggctgccagtgtctgaatcagtg
actagacagacatttaagtttaccagactcactgaaggaaatgagtatgtcttccgcgtg
gctgcaacaaaccgcttcggcattggctcttacttgcagtctgaggtcatagaatgtcgc
agcagcatcagtattcctggacctccagaaacattacagatatttgatgtctcccgtgat
ggcatgacactgacttggtatccaccagaaaatgatggtggctcccaagtgactggatat
attatagagcgcaaagaagtgagagcagatcgatgggtccgtgtaaataaagtaccagtg
acgatgacacggtaccgttccactggccttattgaaggcttagaatatgaacaccgtgtc
acagccattaatgtgagagggactgggaaaccaagtcgtccttccaaacccatcgttgcc
atggatccaattgcgcctccaggaaagccacaaaatccaagagttactgatacaacaagg
acatcagtctctctggcctggagtgttccagaagatgaaggaggatctaaagtcacaggc
tacttgattgaaatgcagaaagtagatcaacacgaatggaccaaatgtaacaccacccca
accaagattcgagagtataccctaacacatctacctcagggtgctgaatacagattccgt
gtcctagcctgtaatgctggtggacctggggagcccgccgaggtaccaggaacagtcaaa
gtcacggaaatgcttgaatatcctgattatgaacttgatgaaagataccaagaaggtatc
tttgtaagacaaggtggagtcatcagacttaccataccaatcaaaggaaaaccattccca
atatgtaaatggaccaaggaaggccaagatgttagtaagcgcgccatgattgcaacctct
gagacacacactgagcttgtaatcaaagaagcagacagggatgattctggcacttacgac
ctggttctggaaaacaagtgtggcaagaaggctgtctacatcaaagtcagggtgatagga
aatcccaaccctcctgaagggccccttgaatatgacgacatacaagctcgctctgtaagg
gtcagttggagaccccctgcggatgatggtggtgccgacatcttaggctatattcttgag
agacgagaagtgtctaaagccgcctggtatacaattgattccagagtccgaggcacatct
ctggtggtaaaaggcctcaaagagaacgtggaataccatttccgtgtttcagctgaaaac
cagtttggcataagcaaacccttgaaatctgaagaaccagtcataccaaaaacaccactg
aatcctccagagcctccaagcaatcctccagaagtactcgatgtgaccaagagttctgtc
agcctgtcttggtcccggcccaaagacgatggtggttctcgagtcacaggctactacatt
gaacgcaaggagacttcaactgacaagtgggtcaggcacaacaagactcagataaccacc
acaatgtacactgtcactgggcttgttcccgatgcagagtatcagttccgcatcatcgca
cagaatgatgttggcctaagtgagaccagccctgcttctgaaccggttgtttgcaaagat
ccatttgataagccaagccaacctggagaacttgagattctttcaatatccaaagatagt
gtcactttacagtgggagaaacctgaatgtgatggtggcaaagaaatccttggatattgg
gttgagtataggcagtctggagacagtgcctggaagaagagcaacaaggagcgcatcaag
gacaggcaattcacaatagggggtttgctggaagccactgaatatgaattcagggttttt
gctgagaatgagaccgggcttagcagacctcgaagaactgctatgtctataaagactaaa
ctaacatctggagaagctccaggagtgcgcaaagaaatgaaggatgttaccaccaagttg
ggcgaagctgctcaactctcatgccagattgttggaaggcctcttcctgacattaaatgg
taccgatttggtaaggagctggtacaaagccggaagtacaaaatgtcttcagacggacgc
acacatacgctaacagtaatgacagaggaacaagaagatgaaggtgtttatacctgcata
gctactaatgaggttggagaagtagaaaccagtagtaagcttctcctgcaagcaacacca
cagttccatcccggttacccactgaaagagaaatattatggtgctgtgggttcgacactt
cgacttcatgttatgtacattggtcgtccggtaccttccatcacttggttctatggccag
aaacttttgcaaaactcagaaaacattactattgagaacactgagcactatactcatctt
gtcttgaagaatgtccaacgtaagactcatgctgggaaatacaaagtccagctcagcaat
gtttttggaacagttgatgccatccttgatgtggagatacaagataaaccagacaaacct
acaggaccaattgtgatagaagctctgttgaagaactctgcagtgatcagctggaaacca
cccgcagatgatggaggctcctggatcaccaactatgtggtggagaaatgtgaggccaag
gaaggggctgaatggcaattggtgtcttcagccatctcggtgacaacctgcagaattgta
aacctcacagaaaatgctggctattacttcagggtttcagcccagaacacttttggcatc
agtgagcctctagaggttgcctcagtcgtgatcattaagagtccttttgaaaagccaggt
gctcctggcaaaccaactatcactgctctcacaaaagattcttgtgttgtggcttggaag
ccacctgccagtgatggaggtgcaaagattagaaattactaccttgagaaacgtgagaag
aagcagaataaatggattgctgtgacaacagaagaaattcgagaaactgtcttttcagtg
caaaaccttattgaaggtcttgaatatgagttccgtgtgaaatgtgaaaatctaggtggg
gaaagtgaatggagtgaaatatcagaacctgccactcccaaatctgatgtcccaattcag
gcaccacactttaaagaggaacttagaaatctaaatgtcagatatcagagcaatgctact
ttggtctgcaaagtgactggtcatccaaaacctattgtgaaatggtacagacaaggcaaa
gaaatcattgcagatggattgaagtacaggattcaagagtttaagggtggctaccaccag
ctcatcattgcaagtgtcacagacgatgatgccacagtttaccaagtcagagctaccaac
caagggggatctgtgtctggcactgcctccttggaagtagaagttccagctaagatacac
ttacctaaaactcttgaaggcatgggagcagttcatgctctccgaggtgaggtggtcagc
attaagatccctttcagtggcaaaccagatcctgtgatcacctggcagaaaggacaagat
ctcatcgacaataacggccactaccaagttattgtcacaagatctttcacatcacttgtt
ttccccaatggagtagagagaaaagatgctggtttctatgtggtctgtgctaaaaacaga
tttggaattgatcagaagaccgtcgaactggatgtggcagatgttcccgacccacccaga
ggagtcaaagttagtgacgtctcacgagattctgtcaacttaacatggactgagccagct
tctgatggtggcagcaaaatcaccaactacattgttgaaaaatgtgcaactactgcagaa
agatggctccgtgtaggacaggcccgagaaacacgttatactgtggtcaacttatttgga
aaaacaagctaccagttccgtgtaatagctgaaaataaatttggcctgagcaagccttct
gagccttcagaaccaaccataaccaaagaagacaagaccagagccatgaattatgatgaa
gaggtagacgaaacaagggaagtttccatgactaaagcatctcactcttcaactaaggaa
ctgtatgagaaatatatgattgctgaagatcttgggcgtggtcagttcggaattgtccac
cgttgtgttgaaacatcctcaaagaagacttacatggccaaatttgttaaagttaagggg
actgatcaggtgttggtaaagaaggagatttccattctaaacattgccaggcacagaaac
atcttatacctccatgaatcatttgagagcatggaagaattagttatgatctttgagttc
atatcaggacttgacatatttgaacgcattaacacaagtgcttttgaacttaatgaaaga
gaaattgtaagttatgttcgtcaggtctgcgaagcacttgagttcttacatagtcataat
atcggacacttcgacattagaccagaaaatatcatttaccaaacaagaaggagctccacc
attaaaatcatagaatttggtcaagcccgtcagctgaagccaggggacaacttcaggctt
ctgttcactgcccccgaatactatgcacctgaagtccaccagcatgacgttgtcagtacc
tccacagacatgtggtcacttggaacattggtgtatgtgctgttaagcggtaccaatcca
ttcatggctgaaactaaccaacagatgattgagaacatcatgaatgctgaatatactttc
gatgaagaagcattcaaagagattagccttgaggcaatggattttgttgaccggctgtta
gtgaaagagagaaaatctcgcatgacagcatccgaggcactccggcatccatggctgaag
cagaagatagaaagagtcagtactaaagttatcagaacattaaaacaccggcgttactac
cacactctggtcaagaaagacctcaacatggttgtgtcagcagcccgaatctcttgtggt
ggtgcaattcgatctcagaagggagtgagtgttgctaaagttaaagtagcatccattgaa
attggcccagtttctggacagataatgcatgcagttggtgaagaaggaggatatgccaaa
tatgtatgcaaaattgaaaattatgatcagtctacccaagtgacctggtactttggagtc
agacagctggagaacagtgagaaatatgaaatcacctatgaagatggagtagccaccatg
tatatcaaagacattaccaaatttgatgacggcacctacagatgcaaagtagtcaatgac
tacggtgaagatagttcttatgcagaactatttgttaaaggtgtgagagaaacttacgac
tattattgccgtagaaccatgaagaaaattaagcgcagaactgacacaatgagactcctg
gaaaggccaccagaatttaccttgcctctctataacaagacagcttatgtgggtgaaaat
gtccgatttggagtaactataactgtccacccagagcctcgtgtaacatggtataaatca
ggtcagaaaatcaaaccaggtgatgatgatgcgaagtacacattcgaatctgacaagggt
ctttaccagttaacaatcagcagtgtaactatagatgatgatgctgaatatacggttgtg
gcaaggaacaaatatggtgaggacagctgcaaggcgaaactgacagtaaccccacaccca
ccgccaacagatacaaccttaagacccatgttcaaacggctgctggcaaacgcagaatgc
caagaaggccaaagcgtctgctttgagatcagagtgtctggcatccccccaccaaaatta
aaatgggagaaagatggccagccactgtcccttgggcctaacattgaaattatccacgaa
ggcctggattattatgccttgcacatcagggacactttgcctgaagacacaggttattat
agggtcacagccacgaacacagctggatccaccagctgccaggctcacctccaagtggaa
cgcttaaggtacgtcaagcaagaatttaagactaaggaggagcgtgaacgacacgtccaa
aagcaaattgacaagacactaagaatggctgaaattctttctggaactgaaacggtgcca
ctgacacaggtagcccaagaggctctgagagaagctgccattctctacaaaccggctgta
agcaccaagaccgtaaaaggggaattccgacttgagacagaagaaaagaaggaagagaga
aaactccgaatgccttatgaagtaccggaaccacgcaagtacaaacagactaccatagaa
gaagaccaacgcattaagcaatttgtgcctatgtccgacatgaaatggtacaaaaagata
cgtgatcaatttgaaatgcctgggaaaattgacagagttgtacagaaaagacccaagcgc
attcgcctttcaagatgggaacagttctatgtgatgcctcttccacgcattacagatcaa
tacagacctaaatggcgtattcccaaactctcccaagatgatcttgaaatggtgagacca
gcccgccgccgcacaccttctcctgattatgacttttattacagacctagaagacgttct
cttggcgacatgtcagacgaagaattactccttcccattgacgactacttggcaatgaaa
agaacagaggaagagaggctgcgtcttgaagaagagcttgagctgggtttctcagcttca
ccgccaagccgaagccctccacgttttgagctttctagtctgcgttactcttcaccacaa
gctcacgtcaaggtggaggaaacaagaaaagacttcagatattcaacctatcacatcccc
accagggctgagaccagcacgagctatgcagaactgcgggaacggcacgcccgggcctcc
tacaggcagccgaaacagcggcagagggtcatggctgagaaagaggaggaagagttgctt
cgcccagttactaccacccagcgactctcaggatacagaagcgagcttgaccacatgtca
aaggaggaaaagtccagaaagaaatcagggcgacagagagaagtgacagaaataacagaa
attgaggaagaatatgaaatctcaaaacacgctcaaagggaggcctcctcaaaacatgct
caaagggagtccgagtcctcctcctcagtgtccaggctactgcggcggcgacgttccctg
tctccaacctatatcgagttaatgaggcctgtgtccgagctaatccggccacgtcggccg
ccagaggaggaatatgaagatgacacagaaagaaggtcccctactccagagagaactcgc
ccacgttcccccagccccgtgtctagtgagagatcactctcaagatttgagaggtctgca
agatttgatatcttttccaggtatgagtccatgaaagctgctttaaagactcagaagaca
tcagaaaggatgtatgaagttttgagtcagcagccttttacgctggaccatgcccctcga
atcacactgagaatgcgctcccacagggtaccatgtggccaaaatacgcgttttatctta
aatgttcagtctaagccaacagctgaggttaaatggtaccacaatggcgtcgaactccag
gaaagcagtaagattcgttacaccaacatgagcggggtattgaccctagaaattctggac
tgccaagctgaggacagcggaacataccgtgccgtgtgcaccaactacaaaggtgaggcc
tcggactacgcgaccttggatgtcacgggcggggattacactacctacacttcccggcgc
agagacgaacaagtgcctccgtcagttttccctgagctgacaagaacagaggaatatgcg
gtttcatcgtttaagaaaacgtctgagatggaagcttcttcttccgtcagggaaatgaag
tcacagatgacagagacaagggaaagtctctcggcctatgaacaccacgcatctgcagaa
atgagaagtgccgccgtagaacagaagtcactggaagaaaaatccacacacagaaagatc
aagacgactttggtgggagcaagaattctgacgaagccaaggtccataactgtgtacgaa
ggcgagtccgcgaggttttcttgcgacacagacggtgagccggtacccactgtaacctgg
ctgcgtggaggccaagtgataagctcttctgcccgccaccaagtgaccaccacaaagtac
aaatcaacctttgagatctcttcggtgcaggcttccgatgagggcaactacagcgtggtg
gtagaaaacagtgaaggcaggcaagaagctcagttcactctgactgttcagaaggccagg
gttactgaaaaggctgtgacgtcaccaccaagcgtcaaatccccagagcctcgagtgaaa
tctccagaagccgttaagtctccaaaacgagtgaagtccccggaaccagtcactactcac
ccaaaagccgtatcacccacagagacaaaacccacaccaacagagaaagttcagcagcta
ccagtgtctgtcccacccaagataactcagtccctgaaagcagaagcatctaaagatatt
gtaaagctgacctgcgcagtcgaaagtagcgtattaagcgcaaaagaggtcacctggtat
aaagatggcaagaaactgaaggaaaatgggcatttccagtttcatttttcagcagatggt
acctgtgagctcaaaatccataacctcacggaatctgatagtggagaatacatttgtgag
atatctagcgaaggtggaacttctaaaacgaacttccactttatgggacaagcctttaag
agtatccatgagcaggtgtcaaggatatcagaaactaagaaggcagctcagaaaaccgtg
gagtcaacagaaaccaagaagactgaaccaaaagctccagagccaatttcctcaaaacca
ataatcgttactgggctgcaggatgcaactgtttcttcagacagcgtcgctaagtttgcg
gtgaaagccactggagaaccccggccgactgtcatctggacaaaggacggaaaggctgtt
acacaaggaagtaagtacaaactctctgaagacaaaggagcttacttcttagaagttcat
aagactgatacttctgacagtgggctttatacctgcacagtaacaaactcagctggatct
gtgtcctctagctgcaaattaactataaaagccgtaaaagatactgaggcacagaaatta
tctacacaaaagacctctgaaattacgtcacaaaagaaggcggctgtccaagaggaaatt
tcccaaaaagccctaatttctgaagaaatgaaactagcagagggtaaatctcaagagaag
gcggttgtccaagaggaaatttcccagaaagctctaatttctgaagaaatgaaaaaatca
gaggtgaaatctcaagaacagttagccctcaaggaggaagcctcgaaggttcggatttct
gaaaaagtcaagaaatcagaagcaacctctctggaaaaatccattgtccatgaggaaatc
actaaaacatcacaggcatcagaagaaatcagaacgcatgcggagattaaagcattttct
actcagatgagcataactgatggtcagaaagtgaccttaaaagccaacattgctggtgcc
acggatgtgaaatgggtactgaatggcgtagagctcgctaactctgaggagtacagatac
ggtgtctcgggcagcgatcagaccctaaccatcaagcaggccagtcacaaagatgaaggg
atcctcacttgcataggcaaaaccagccaagggatcatcaaatgtcagtatgatctgatg
ctgagcaaagcactctcagatgctccagccttcatctcccagcccagatctcaaaatatt
aacgagggacaaaatgttttcttttcttgtgaaatcagtggtgagccatccccggaaatc
gaatggtttaaaaacaacttgccgatttctgtttcttcaaatatcagtgtaagtcgctcc
agaaatgtatattctcttgaaatccgaaatgcatcagtaagcgacagtggaaagtacaca
gttaaggccaaaaatttccgtggccagtgttcagctactgcttccttaacggtccttccc
ctagttgaagaacctcccagagaggtagtattgaggacaagtggtgacacaagcttgcaa
ggaagcttctcgtctcagtcagtccaaatgtctgcctccaagcaggaggcatccttcagc
agtttcagcagcagcagtgctagcagcatgactgaaatgaaatttgcaagcatgtctgcc
caaagcatgtcctccatgcaagagtcctttgtagaaatgagttccagcaattttatggga
aaatctagtatgacacaactggaaagctcaactagtagaatgcttaaaccaggcgtaaga
ggaattccacctaaaattgaagcgcttccctctgacatcagcattgatgtgggcaaagtt
ttaacagtagcctgtgcttttacgggtgagcctaccccagagataatatggtcccgtgga
ggaagaaaaattcaaaaccaagaacaacatgggcgattccacattgaaaacacagatgac
ctgacaactctcatcatcatggatgtacagaaacaagatggtggactttataccctgagc
ttagggaatgaatttggatctgactctgccactgtgaatataaatattcgatccatgtaa

DBGET integrated database retrieval system