KEGG   Ailuropoda melanoleuca (giant panda): 100477111
Entry
100477111         CDS       T01329                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aml01002]
    100477111
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100477111
Peptidases and inhibitors [BR:aml01002]
 Metallo peptidases
  Family M1
   100477111
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 100477111
NCBI-ProteinID: XP_034512435
Ensembl: ENSAMEG00000012988
Position
3
AA seq 561 aa
MISLSIKWPLATMLFLLSSLLILLTVSTRSWCQSSDTMSPKASNGTPFPWEKMRLPEHII
PVHYDLLIHANLTTLTFEGTTEIEITASQPTSTIILHSHRLQISKATLKKRGRERLSAEP
LTVLEYPAHEQIALLAPEPLVVGLPYVIVIDYAGHLSEHLQGFYKSTYRTKEGEVRVLAS
THFEPTAARMAFPCFDEPAFKANFSVKIRREPRHLAISNMPLVKSVTVAEGLLEDHFAVT
VKMSTYLVAFIISDFKSISKMTKSGVKVSIYAVADKIHQADYALDTAVTLLEFYEDYFRI
PYPLPKQDLAAIPDFESGAMENWGLTTYRESILLFDAEKSSASDKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFLGKCFDVMELDALNSSHPV
STAVENPAQIREMFDEVSYKKGACILNMLRDYLSAEAFKSGIVRYLQKYSYKNTRNEDLW
NSMASICPTDDSQSMEGFCSRDPHSSSASHWRQEGLDVKTMMNTWTLQKGFPLITVTVRG
RNVHVRQELYRKGPEDTSETG
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgatatctctgtccatcaaatggccactggcaaccatgctgtttctactgtcctcgctg
ttgattctcttaactgtgtcaactcgttcctggtgtcagagcagtgacactatgtctcca
aaagctagtaatgggactccattcccttgggagaaaatgcggcttcctgagcacatcatc
ccagttcattatgatctcctgatccatgcaaatctcaccactctgactttcgagggaacc
acggaaatcgaaatcacagccagccagcctactagtaccatcatcctgcacagtcaccgc
ctgcaaatatctaaggccaccctcaagaagagaggcagagagaggctgtctgcagaacca
ttgaccgtcctggaatacccggctcatgagcaaatcgcacttctggcccccgagcctctg
gttgttgggctcccgtacgtcattgtcatcgactacgctggccatctttctgagcactta
caaggattttataaaagcacctacagaacaaaggaaggcgaagtgagagtacttgcatca
acacactttgaacccactgcagcgagaatggcgtttccctgctttgatgaacccgccttc
aaagcgaatttttcagtcaagatcagaagggagccaagacacctcgccatctccaatatg
ccactggttaagtctgtgactgtcgccgaaggactcctcgaagaccattttgctgtcact
gtgaagatgagcacctacctggtggccttcattatctcagactttaagtctattagcaag
atgaccaagagcggagtcaaggtttccatatatgctgtggctgacaagatacatcaggcg
gattatgccctggataccgcagtgactcttctagaattttacgaggattatttcaggatt
ccatatcccttacccaaacaagatcttgctgccattcctgactttgagagtggtgctatg
gaaaactggggactgaccacatacagagaatctattctcttgtttgacgctgagaagtcg
tctgcgtcggataagcttggcattacgatgacggtgtcgcatgaactcgcccaccagtgg
tttgggaacctcgtcaccatggaatggtggaatgatctttggttaaacgagggatttgcc
aagtttatggagtttgtgtccgtcagtgtgactcatcctgaactgaaagttgaagattat
ttcctcggcaagtgttttgacgtgatggagctggatgcgttaaattcgtcacaccctgtg
tccacagctgtggagaatcctgctcagattcgcgagatgtttgatgaggtttcttataaa
aagggagcttgtattctgaatatgctaagggattatctcagtgccgaagcatttaaaagc
ggtattgtacgttatctccagaagtacagctacaaaaacacgaggaatgaggacctgtgg
aatagtatggcaagtatttgccctacagatgactcacagagcatggaaggcttttgctcc
agggatccacattcatcttcagcctcacactggcggcaggaaggccttgacgtaaaaacc
atgatgaacacgtggacgctgcagaaaggctttcccctgataaccgtcacggtgagaggg
aggaacgtacacgtgaggcaggagctctacaggaaaggacccgaggacacctcagaaact
gggtaa

DBGET integrated database retrieval system