KEGG   Ailuropoda melanoleuca (giant panda): 100477233
Entry
100477233         CDS       T01329                                 

Gene name
KAT7
Definition
(RefSeq) histone acetyltransferase KAT7 isoform X1
  KO
K11307  histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100477233 (KAT7)
   03036 Chromosome and associated proteins [BR:aml03036]
    100477233 (KAT7)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100477233 (KAT7)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Zinc finger
   Cys2HisCys zinc factors
    100477233 (KAT7)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100477233 (KAT7)
   HAT complexes
    HBO1 complex
     100477233 (KAT7)
SSDB
Motif
Pfam: MOZ_SAS zf-MYST zf-C2HC Acetyltransf_7 zf-met
Other DBs
NCBI-GeneID: 100477233
NCBI-ProteinID: XP_002923779
Ensembl: ENSAMEG00000012243
UniProt: G1M0R5
Position
13
AA seq 611 aa
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQ
DDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLEN
LTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDP
SCLKWTPPKGT
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgccgcgaaggaagaggaatgcaggcagtagttcagatggaaccgaagattccgatttt
tctacagatctcgagcacacagacagttcagagagtgatggcacatcccggcgatctgcc
cgagttactcgctcttcagcccggctgagccagagttcccaagattccagtcctgttcga
aatttgcaatcttttgggactgaggagcctgcttattctaccagaagagtgacccgtagt
cagcagcagcctaccccggtgactccgaaaaaatacccacttcggcagactcgttcgtct
ggctcagaaactgagcaagtggttgacttttcagatagagaaactaaaaatacagctgat
catgatgagtccccacctcgaactccaactggaaatgccccatcttctgagtctgacata
gacatctccagccccaacgtgtctcatgatgagagcattgccaaggacatgtccctgaag
gactcgggcagcgatctctctcatcgccccaagcggcgtcgcttccatgaaagctacaat
ttcaatatgaagtgtcctactccaggctgtaactctctaggacatcttacaggaaaacat
gagagacatttttccatctcaggatgcccgctctatcataacctgtcagctgatgagtgc
aaggtgagagcacagagccgggataagcagatagaagagaggatgctgtcccacaggcaa
gatgacaacaacaggcatgcaaccaggcaccaggcgccaacagagaggcagctgcggtac
aaggagaaggtggctgaactcaggaagaaaaggaattccgggctgagcaaagagcagaaa
gagaaatacatggaacacagacagacctatgggaacactcgggaacctctcttggaaaac
ctgactagcgagtatgacttggatcttttccgaagagcacaagcccgggcttcagaggat
ttggagaagttaaggctgcaaggccaaatcacagaggggagcaacatgattaaaacaatt
gcttttggtcgttatgagcttgatacttggtaccattctccctatcccgaagaatacgca
cgcctgggacgtctctacatgtgcgaattctgcttaaaatacatgaagagccaaacgata
ctccgccgacacatggctaaatgtgtgtggaagcacccacctggtgatgagatctatcgt
aaaggctccatctctgtgtttgaagtggatggcaagaaaaacaagatctactgccaaaac
ctgtgtctgttggccaagctttttctggaccataagacgttgtattatgatgtggagccc
ttcctgttctacgtgatgacagaagcggacaacaccggctgtcacctgattggatatttt
tccaaggaaaagaattcattcctcaactacaacgtgtcgtgtatcctcaccatgcctcag
tacatgagacagggctatggcaagatgctcatcgatttcagttacttgctttccaaagtg
gaagaaaaagtcggctccccggaacgtcccctctctgacctggggctcataagctatcgc
agttactggaaagaagtgctgctccgttacctgcataatttccaaggcaaagagatttct
atcaaagaaattagccaggagacagctgtgaatcctgtggacatcgtcagcactctgcaa
gcccttcagatgctcaagtactggaaaggaaaacacctagttttaaagagacaggacctg
attgacgagtggatagccaaagaggccaaaagatccaactccaataaaaccatggatcca
agctgtttaaaatggacccctcccaagggcacttaa

DBGET integrated database retrieval system