KEGG   Ailuropoda melanoleuca (giant panda): 100477613
Entry
100477613         CDS       T01329                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100477613 (RDH5)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     100477613 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 100477613
NCBI-ProteinID: XP_019648691
Ensembl: ENSAMEG00000011837
UniProt: G1LZD8
Position
15
AA seq 318 aa
MWLPLLLGVLLWAALWLLRDRQSLPASDAFIFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDVTDPQSVQRAAKWVETHVGEAGLFGLVNNAGVAGIIGP
TPWLTQNDFRRVLNVNTLGPIGVTLALLPLLQRARGRVVNVTSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAHFGVRVSIVEPGFFQTPVTNLKCLEDTLQECWVRLPPTTQALYGEA
FLTRYLEVQQRVMNLISDPDLTKVSRCLEHALTARYPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQAVC
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgctgctgggagtcctgctctgggcggcgctgtggttgctcagggac
cgccagagcctgcccgccagcgatgctttcatcttcatcaccggctgcgactcaggcttc
gggcggcttttggcactgagactggaccagagaggcttccgagtcctggccagctgcctg
accccctcgggggcagaggacctacagcgggtggcctcctcccgcctccacaccaccctg
ctggatgtcactgatccccagagtgtccagcgggcagccaagtgggtggaaacacacgtc
ggggaagcagggctttttggtctggtgaataacgctggtgtggccgggatcatcgggccc
acaccgtggctcacacagaatgatttccgtcgggtgctgaacgtgaatacactgggtccc
atcggcgtcaccctcgccctgctgccactgctgcagcgggcccggggccgggtggtcaac
gtcaccagtgttttgggtcgcctggcagccaatggcgggggctactgtgtctccaagttc
ggcctggaggccttctctgacagcctgaggcgggatgtggctcattttggggtccgagtc
tccatcgtggagcctggcttcttccaaacccctgtgacaaatctcaagtgtttggaggac
acactgcaggagtgctgggtacggctacctcccaccacacaggccctctatggggaggcc
ttcctcaccagatacttggaagtgcagcagcgcgtcatgaacctgatcagtgacccggac
ctgaccaaagtgagcaggtgcctggagcatgccctgactgctcgctacccgagaacccgg
tacagcccaggctgggacgctaagctgctctggctgccggcctcctacctgccagccagc
ctggtggacgctgtgctcacctgggtccttcccaaacccgcccaggcagtctgctga

DBGET integrated database retrieval system