KEGG   Ailuropoda melanoleuca (giant panda): 100478269Help
Entry
100478269         CDS       T01329                                 

Gene name
LYPLA1
Definition
(RefSeq) lysophospholipase I
  KO
K06128  lysophospholipase I [EC:3.1.1.5]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00564  Glycerophospholipid metabolism
aml05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100478269 (LYPLA1)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    100478269 (LYPLA1)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100478269 (LYPLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Abhydrolase_3 Hydrolase_4 Cutinase DLH DUF2974 Abhydrolase_1 Lipase_3 Esterase FSH1 Abhydrolase_6 AXE1
Motif
Other DBs
NCBI-GeneID: 100478269
NCBI-ProteinID: XP_011235922
Ensembl: ENSAMEG00000012413
Position
Un
AA seq 172 aa AA seqDB search
MPVTLNMNMAMPSWFDIIGLSPDSQEDEPGIKQAAENVKALIEQEVKNGIPSNRIVLGGF
SQGGALSLYTALTTEQKLAGVTALSCWLPLRASFPQGPISGVNRDISILQCHGDCDPLVP
LMFASLTAEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDIKQFIDKLLPPVD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaacattgaatatgaacatggctatgccttcttggtttgatattattgggctt
tcaccagattcacaggaggatgaacctggaattaaacaggcagcagaaaatgtaaaagct
ttgatagagcaagaggtgaagaatggcattccttctaacagaattgttttgggaggattt
tctcagggaggagctttatctttatacactgctcttaccacagagcagaaactggccggt
gtcactgcactcagttgctggcttccactccgggcttcatttccacagggtcctatcagt
ggcgttaatagagatatttctattcttcagtgccatggagattgcgatcctttagttccc
ctaatgtttgcttctcttactgccgaaaagctgaaaacattagtaaatccagccaatgta
accttcaaaacctatgaaggcatgatgcacagttcatgtcaacaggaaatgatggatatc
aagcagttcattgataagcttctacctccagttgattga

DBGET integrated database retrieval system