KEGG   Ailuropoda melanoleuca (giant panda): 100478420Help
Entry
100478420         CDS       T01329                                 

Definition
(RefSeq) stromelysin-1
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04657  IL-17 signaling pathway
aml04668  TNF signaling pathway
aml05202  Transcriptional misregulation in cancer
aml05215  Prostate cancer
aml05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100478420
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100478420
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100478420
  09162 Cancer: specific types
   05215 Prostate cancer
    100478420
  09163 Immune disease
   05323 Rheumatoid arthritis
    100478420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aml01002]
    100478420
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     100478420
Peptidases and inhibitors [BR:aml01002]
 Metallo peptidases
  Family M10
   100478420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_3 Reprolysin_5 Reprolysin_4 DUF4953
Motif
Other DBs
NCBI-GeneID: 100478420
NCBI-ProteinID: XP_002922061
Ensembl: ENSAMEG00000010203
Position
Un
AA seq 476 aa AA seqDB search
MQNLPALLSLCVAVCSAYPVDRASEDEDSMELVQQYLENYYNLAKDTKPFVRRRDGGPVV
EKLREMQKFLGLEVTGKLDSDTLEMMHKPRCGVPDVGDFTTFPGMPRWRKTHLTYRIMNY
MLDLPRDAVDSAIEKALSLWEEVTPLTFSKADDGEADIKILFAVRDHGDFNPFDGPGKVL
AHAYPPGPGIYGDAHFDDDEPWTRDTSGTNLFLVAAHELGHSLGLFHSADPRALMYPVYN
ARTDLARLRLSQDDVAGIQSLYGSPSVSPDDPAVPPESVPPGPETPAACDPSLSFDAIST
LRGEILFFKDRHFWRKSLRTLEPGFYLISSFWPSLPSGLDAAYEETSKDIVFVFKGNQFW
AIRGTEAQAGYPKSIHTLGFPSTVRKIDAAIFDKEKKKTYFFVGDKYWRFDERRRSMEPG
FPRQIAEDFPGVDPKVDAAFEAFGFYYFFNGSSQLEFDPNAREVTHSLKSNSWLNC
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaccttccagctctgctgtctctctgtgtggctgtgtgctcggcctacccagtg
gacagagcctcggaggatgaggacagcatggaacttgtgcagcaatacctggaaaattac
tacaaccttgcaaaagataccaaaccatttgttagaagaagggacggtggtcctgttgtt
gaaaaactccgagaaatgcagaagttcctcgggctggaggtgacggggaagctggactcg
gacactctggagatgatgcacaagcccaggtgtggggtccccgatgtcggcgacttcacc
accttccctggcatgccgaggtggaggaaaacacaccttacttacaggattatgaattat
atgctggatttgccaagagacgctgttgattctgccattgagaaagctctgagcctctgg
gaggaggtgactccactgactttctccaaggctgacgacggagaggctgacataaagatc
ttatttgcagttagagatcatggggattttaacccctttgatggacctggaaaagttctg
gctcatgcctacccgcccgggcccggcatttacggagatgcgcactttgacgatgacgag
ccatggacgagggatacttccggaaccaatttattcctggttgccgctcatgaacttggc
cattccctgggtctcttccactcggccgaccctcgcgccctgatgtacccggtctacaac
gcgcgcacagacctggcccgcctccgcctttctcaagatgacgtggctggcatccagtcc
ctgtacggatctccctctgtctccccggatgaccccgcggtgcccccggaatctgtgcct
ccaggacccgagaccccagccgcgtgcgaccccagtttgtccttcgacgcaatcagcact
ctgaggggagaaatcctgttcttcaaagacaggcatttttggcgcaaatccctcaggacg
cttgaacctggattttacctgatctcctcgttttggccctcccttccttcaggcctggat
gctgcatatgaagaaactagcaaggacattgttttcgtttttaaaggaaatcagttctgg
gccatcagaggaactgaggcacaagctggttatccaaaaagcatccacaccctcggtttt
ccctcaaccgtaaggaaaattgatgcagccatttttgataaggaaaagaagaaaacgtac
ttctttgtaggagacaaatactggcgatttgatgagaggagacgatccatggagccaggc
ttccccaggcaaatagcagaagacttcccaggggttgaccccaaggtcgatgctgctttt
gaagcatttgggttttactatttcttcaatggatcttcacagctggagtttgacccaaat
gctagggaagtgacacattccttgaagagcaacagctggttgaattgctga

DBGET integrated database retrieval system