KEGG   Ailuropoda melanoleuca (giant panda): 100478611Help
Entry
100478611         CDS       T01329                                 

Gene name
TBX6
Definition
(RefSeq) T-box 6
  KO
K10180  T-box protein 6
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100478611 (TBX6)
   03019 Messenger RNA biogenesis [BR:aml03019]
    100478611 (TBX6)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Other transcription factors
   T-box
    100478611 (TBX6)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100478611 (TBX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box
Motif
Other DBs
NCBI-GeneID: 100478611
NCBI-ProteinID: XP_002927405
Ensembl: ENSAMEG00000015253
Position
Un
AA seq 432 aa AA seqDB search
MYHPRELYPSLGTGYRLGPPQPGTDSSFPPALAEGYRYPDLDTPKLDCFLSGIEAAPXQL
APALGTEPAPPAPEALHSLPGVSLSLENRELWKEFNSVGTEMVITKAGRRMFPACRVSVT
GLDPEARYLFLLDVVPVDGAGXXGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPATGAH
WMRQPVSFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGVASFRFPET
TFISVTAYQNPRITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPVAAEAYGSR
DAPGGPCDSTLGGDVRESDPEQAPAPREAAPAPAPPCGGSSAEAYLLHPAAFHGAPSHLP
TRNPSFPEAPDSGRPTPYSAAFLELQPGPGGSGYPAAAPPAPFASHFLQGGPFPLAYPGP
GAYLDVGSKPMY
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtaccatccacgagagttgtacccctccctggggacaggctaccgccttgggcccccc
cagccggggacagattccagcttcccgcctgccctggcagagggctaccgctaccctgat
ctggacactcccaagttggattgcttcctgtccgggattgaggctgctcccntgcagctg
gcccccgccctgggcactgagccggcccccccagccccagaggcccttcattcgctcccc
ggagtcagcctgagcctggagaaccgggagctgtggaaagagttcaactctgtgggaaca
gagatggtcatcaccaaagctgggaggcgcatgttccctgcttgtcgagtatcagtcact
ggcctggaccccgaggcccgctacctgtttcttctggatgtggttccagtggatggggca
ggctannatggggctcgctaccgctggcagggccggcgctgggagcccagtggcaaggcg
gagccccgcctgcctgaccgcgtctacattcaccccgactctcctgccacgggcgcgcac
tggatgcggcagcctgtgtccttccatcgtgtcaagctcaccaacagcaccctggacccc
cacggccatctgatcttgcactccatgcacaagtaccagccccgcatacacctggtgcgg
gcagcccagctctgcagccagcactgggggggggtcgcctccttccgcttccctgagacc
acattcatctctgtgacagcctaccagaacccgcggatcacacaactgaagatcgcagcc
aatccctttgccaagggcttccgggagaacggcagaaactgtaagagggagcgagatgcc
cgtgtgaagaggaaactgcggggcccggagccggtagccgcagaggcctatgggagtaga
gatgcaccaggcggtccctgtgattccacgctgggtggggacgtccgcgagtcggaccca
gagcaggccccggccccccgcgaagctgccccagcgccagcccctccgtgtggtggctcc
agtgccgaagcctaccttctgcaccccgcggcttttcatggggcccccagtcaccttcca
accaggaaccccagcttccctgaggctccagactcggggcgtccgaccccctactcagct
gcgttcctggagctgcagcctgggccagggggctcaggatacccagcagctgcacccccg
gcaccctttgcctcgcacttcctccaggggggtccgttcccccttgcctaccccggccct
ggggcttacctggatgtgggctccaaaccaatgtactga

DBGET integrated database retrieval system