KEGG   Ailuropoda melanoleuca (giant panda): 100478915
Entry
100478915         CDS       T01329                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aml03021]
    100478915 (AFF3)
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100478915 (AFF3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 100478915
NCBI-ProteinID: XP_034514878
Ensembl: ENSAMEG00000013204
Position
4
AA seq 1293 aa
MNICRNKHINCTLFCLCVYEPDRNVLRRKERERRNQETQQDDGTFNSSYSLFSEPYKTNK
GDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQAPVNKIDEHFVADSRTQTQ
PPSVCSTASSTPAAVPVQQSKRGSMGWPKAGHPPSDGQQRASKHGHRLLDLNRSANPKNH
NKKPNQSVSSPSSSSSSSSSSSSSSSNSAQQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQ
TQERPPAMAAKHSGSGHCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSS
TETSVHCTSYRGVPATKPESARAKAKLSKFSIPKQGEESRSGDTNSCVEEIIREMTWLPP
LSAVPAPGKVEPSKFPFPNKDSQLVSSGHNNPKKGDAEPESPDNGTSNTSSLEWLSPFTD
KGNDAQRGMLEDDLKLSSDEEENEQQAAQRTALHALSDSGVVQQANCRASVPSSKGSSSG
SSSSGSSSSSDSESSSGSDSETESSSSESEGSKPPHYSSPEAEPASSNKWQLDKWLNKVN
PHKPPLLIQNESHGPESNQYYTPAKEEVQDCGKLPDVCQTSLREKDIKSACKEEQRPRTA
NKAPGSKGVKQKSPPAAVAVAVTTAAQPPAVPAAPPDNAPAPARRSAGKKPTRRTERTSA
GDSTNCHRPEEPAAADALGASVVIPPEPTKTRPCGNSRTSHRKELRSSVTCEKRRTRGLG
RIVPKSKEFIETESSSSSSSSDSDLESEQEEYPLSKAQAAATTTAVSSGSDQRLKEAASS
ISSGGGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDEVRSLWVKIDL
TLLSRIPEHLPQEPGVLNAPAAKDAESTQPSHPSDTPAEKALPKSKRKRKCDNEDDYREV
KKAQGEKESSSRLPASASNTLSANHCSMNINSLAIPINKNEKMLRSPISPLSDASKHKYS
SEDLTSSSRSNGSGLFTSASSNKKHKTENQLQSHAGDLMKATHNNSENVLHKSRPQTEPW
SPGANSHRDCKRQKLVFDDMPRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIE
CGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYW
RMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGTPSPMSPNPSPTSSVGSQ
GSLSNASTLSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLD
LLMGPVTLHSSMEHLVQYSQQGLHWLRNSTHLS
NT seq 3882 nt   +upstreamnt  +downstreamnt
atgaacatctgccggaacaagcatattaactgcactctgttctgcctctgtgtctatgaa
ccagatagaaatgtgttacgaaggaaagaacgagaaagaagaaatcaggaaactcagcag
gatgatggcacatttaattcgagttactccctcttcagtgaaccctacaagacgaacaag
ggggatgagctctccaaccggatccagaatactttaggcaattatgatgaaatgaaagac
tttttaactgatagatctaatcagagtcatctcgttggtgttcccaaacctggggttcct
caggctcctgtgaacaagatcgatgaacattttgttgcggattcaagaacccagactcag
ccgccatctgtctgtagcactgcgtcttccacaccagcagctgtccccgtgcagcagagt
aagcggggcagcatgggctggccaaaggctgggcacccgccatcggatggccaacagaga
gcaagtaagcacggacacaggttgcttgatttgaacagatctgctaacccaaagaaccat
aataaaaaacctaaccagtctgtgtcgagcccttcatcctcatcttcctcttcttcttcc
tcttcttcttcttcttccaactcagcacaacaaggctctctgaggaccttgcttggagat
ggtgtgggcagacagcagccacgagccaaacaagtgtgcaatgtagaggtgggtcttcag
acccaggaaaggccccctgctatggcagccaagcacagcggcagtggacactgtgttcag
aactttcctccgtccctggcttcaaaacccagcttggtccagcagaaaccaactgcatac
gtgcggccgatggacggccaagatcaggctcctgatgagtctccaaagcttaagtcgtcc
acagaaaccagtgtgcactgcacgtcctacaggggagtcccggccaccaagccagagtcc
gccagagccaaggccaagctttccaagttcagcatccccaaacaaggagaggagagtaga
tctggagacacaaacagctgtgtggaagaaataattcgggagatgacctggctcccacca
ctttctgctgttccagcacctggcaaagtggaaccaagcaaatttccatttccaaataag
gactctcagcttgtttcctccggacacaataatccaaagaaaggtgatgctgagccagag
agtccagacaatggcacatcgaatacatcctctctggaatggttatctccatttacagat
aagggaaatgatgcacagagaggaatgctagaagatgaccttaagctaagtagtgatgaa
gaggagaatgagcagcaggcagcccagagaactgctctccacgctctgtctgacagcggc
gtggtccagcaggccaactgcagagcctccgtgccttccagcaagggcagcagcagcggc
agcagcagcagcggcagcagctcgtccagtgactcagagagcagctctggatctgactcg
gagactgagagcagttccagcgagagtgagggcagcaagcctccccactactccagcccc
gaggctgaacccgcgtcctctaacaagtggcagctggataaatggctaaacaaagttaat
ccccacaagccacctcttctgatccaaaatgaaagccacggaccagagagcaatcaatac
tacactccagcgaaagaggaagtgcaggactgtgggaaacttcccgacgtttgccaaacc
agcctgagagagaaggacatcaagagcgcctgcaaggaggagcagaggccaaggacagcg
aacaaggccccggggagtaaaggagtgaagcagaagtccccgcccgcggctgtggccgtg
gctgtgaccacagctgcccagccgcccgctgtgcccgccgcgccccccgataacgcgcct
gcgcccgcccggaggtcagcgggaaagaagcccaccaggcgcaccgagaggacctccgcc
ggcgacagcaccaactgccaccggcctgaggagcccgcggctgcagacgcgctgggggcg
agcgtggtgatccctccagagcccaccaaaaccaggccttgtggcaacagcagaacgagc
caccgcaaggaactgcgctcctcggtgacctgcgagaagcgccgcacgcgggggctgggc
aggatcgtccccaaatccaaggagttcatagagacagagtcgtcatcttcttcctcctcc
tcagactcggacctggagtcagagcaggaggagtaccctctgtccaaagcgcaggccgcc
gccaccaccactgccgtctcctcggggagtgaccagaggctgaaggaggcggccagcagc
attagcagtggtggcgggccccgggcccccgtgggctccatcaacgccaggaccaccagt
gacattgccaaggagctggaggagcagttctacacgctggtccctttcggccgcaatgaa
cttctctcccccttgaaggacagtgatgaggtcaggtctctctgggtcaaaattgacttg
accctcctgtccaggatcccagaacacctgccccaggagcccggggtcttgaatgccccc
gcagccaaggacgctgagagcacgcagccaagccatccatctgacacgcctgccgaaaag
gctctgccaaaatccaagaggaaacgcaagtgtgacaacgaagacgactacagggaggtc
aagaaggcccagggagagaaagagagctcttcacgactgcccgcctctgccagtaacact
ttatctgcaaaccactgcagcatgaacatcaacagcttggcaataccaataaataaaaat
gaaaaaatgctccggtcacccatctcacccctctcggatgcatctaaacacaaatactcc
agcgaggacttaacttcttctagcagatcaaatggcagtggcttgttcacttctgcctcc
tccaacaaaaagcataagactgagaaccagctacagtctcatgccggagacctcatgaaa
gccactcacaacaattccgaaaatgttctccacaagtcacggccacagacagagccatgg
tctccaggtgccaacagccacagggactgcaagaggcagaaacttgtcttcgatgatatg
ccacgcagtgcagattattttatgcaggaagctaaacggatgaagcataaagcagatgcg
atggtggaaaagtttggaaaggctttgaactacgctgaagcagctttgtcatttattgag
tgtggaaacgcaatggaacaaggcccgatggaatctaaatctccttatacaatgtattcg
gaaacagtagagctcatcaggtatgctatgagactaaaaacccattcaggccccaatgcc
accccagaggacaaacagctggctgcattatgttaccgctgcctggctctcctgtactgg
cggatgtttcgactcaaaagggaccacgctgtgaagtattcaaaagcacttattgactat
ttcaagaattcatctaaagctgcccaagccccatctccatggggagccagtggaaagagc
actggaactccatcccctatgtctcccaacccctccccgaccagctccgtgggatctcag
gggagcctctccaatgccagcaccctgtccccttcaaccatcgtcagcattccacagcgc
atccaccagatggcagccaatcacgtcagcatcaccaacagcattctccacagctatgac
tactgggagatggcggacaacctggccaaggaaaacagagaattcttcaacgacttggat
ttgctcatggggcctgtcaccctgcacagcagcatggaacatctggtccagtactcccag
cagggcctgcactggctgcggaacagcacccacctttcatag

DBGET integrated database retrieval system