KEGG   Ailuropoda melanoleuca (giant panda): 100479289Help
Entry
100479289         CDS       T01329                                 

Gene name
FKBP1A
Definition
(RefSeq) FK506 binding protein 1A
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aml03110]
    100479289 (FKBP1A)
Enzymes [BR:aml01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100479289 (FKBP1A)
Chaperones and folding catalysts [BR:aml03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    100479289 (FKBP1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 100479289
NCBI-ProteinID: XP_002930372
Position
Un
AA seq 87 aa AA seqDB search
MGVTACWGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDY
AYGATGHPGIIPPNATLVFDVELLKLE
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgggagtaaccgcctgctgggggatgcttgaagatggaaagaaatttgattcctcccgg
gacagaaacaagccctttaagtttatgctaggcaagcaggaggtgatccgaggctgggaa
gaaggggttgcccagatgagtgtgggtcagagagccaaactgaccatctccccagactac
gcctacggtgctactgggcacccaggcatcatcccgccaaacgccactctcgtctttgac
gtggagcttctgaaactggaatga

DBGET integrated database retrieval system