KEGG   Ailuropoda melanoleuca (giant panda): 100479651Help
Entry
100479651         CDS       T01329                                 

Gene name
TYW3
Definition
(RefSeq) tRNA-yW synthesizing protein 3 homolog
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aml03016]
    100479651 (TYW3)
Enzymes [BR:aml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     100479651 (TYW3)
Transfer RNA biogenesis [BR:aml03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    100479651 (TYW3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 DUF3440
Motif
Other DBs
NCBI-GeneID: 100479651
NCBI-ProteinID: XP_002916953
Ensembl: ENSAMEG00000003461
UniProt: D2H5D6
Position
Un
AA seq 259 aa AA seqDB search
MDRTAEFRRWKAQCLSKADLSRKGGVDEDVVEFVQLLNEREQYFTTSSCAGRIILLDGGI
NGFEVQKQNRCWLLVTHKPCVKDDVMAALKKATGDAILKFEPLVLHVQCRRLLDAQILHS
VAIDSGFRNSGITVGKRGKTMLAIRSTHGLEVPLSNKGKLMVTEEYIDFLLKIANQKMEE
NKKRIERFYNCVQHALEKETITNLHPKEKIKDKNNSSYTRKKKRNPEEAHGKCITEENDK
ECENDDDPGISVSIFPEDY
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtaccgcagagttcaggagatggaaggcgcagtgtctgagcaaagcggacctc
agccggaagggtggtgtggacgaggatgtggtagaatttgtgcagctcctgaatgagcga
gaacagtacttcaccaccagttcctgcgctgggcgcatcatcctcctggatgggggtata
aatggttttgaggttcaaaagcaaaaccgttgctggctactggttacacacaaaccttgt
gtaaaggatgatgtgatggcagctctgaagaaagcaactggtgatgccattttgaaattt
gaaccacttgttcttcatgtgcagtgtcgacggttgctggatgcacagattctgcattca
gtggcaatagattctggtttcaggaactccggcatcaccgtgggaaagagaggaaagact
atgttggctatccggagcacacatggcttagaagttccattaagcaataagggaaaactg
atggtaactgaggaatatattgacttcctgttaaagatagcaaatcagaaaatggaagaa
aacaagaagagaattgaaaggttttacaactgcgtacaacatgctttggaaaaagaaact
attactaacttacatcccaaagagaaaatcaaagacaaaaataattcatcatatactcgt
aagaagaaaagaaacccagaagaagcacatggcaaatgtattactgaagaaaatgataaa
gaatgtgaaaatgatgatgacccaggaatcagtgttagtatcttccctgaagattactaa

DBGET integrated database retrieval system