KEGG   Ailuropoda melanoleuca (giant panda): 100480317Help
Entry
100480317         CDS       T01329                                 

Definition
(RefSeq) arylamine N-acetyltransferase 1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00232  Caffeine metabolism
aml00983  Drug metabolism - other enzymes
aml01100  Metabolic pathways
aml05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100480317
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100480317
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100480317
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     100480317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 100480317
NCBI-ProteinID: XP_002915764
Ensembl: ENSAMEG00000019621
UniProt: D2H2C9
Position
Un
AA seq 290 aa AA seqDB search
MDIEAYFERIGYRNSRKKLDLETLTDILQHQIRAIPFENLNIHCGEAMELGLEVIFDQIV
RKNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPANKYSKAMIHLLLKVTTDGRNYI
VDAGFGRSYQMWQPLELISGQDQPQVPCIFHLTEDKGIWYLDQIRRQQYIPNQEFLNSDL
LEKNKYRKIYSFTLEPRTIEDFESVNTYLQISPTSVFTSKSFCSLQTSEGVHCLVGCTLT
YRKFNFKGNMDLIEFKILNEEEVEKNLKNIFNISLERKLVPKHGDQFFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaagcatattttgaaagaattggttataggaactctaggaagaaattggac
ttggaaacattaactgacattcttcagcaccagatcagagccattccctttgagaacctt
aacatacattgtggggaagccatggaattgggcttggaagtgatttttgatcaaattgtg
agaaagaaccgtggtgggtggtgtctccaggtcaatcatcttctgtactgggctctgacc
acaatcggttttgagaccacaatgttgggagggtatgtttacagtactccagccaacaaa
tatagcaaagctatgatccaccttcttctaaaggtgactactgatggcaggaattacata
gtggatgctgggtttggacgttcttaccaaatgtggcagcctctggagttaatttctggg
caggatcaaccacaggtgccttgcatcttccacttgacagaagacaaaggaatctggtac
ttggaccaaatcagaagacagcagtacattccaaaccaagaatttcttaattctgatctc
ctggaaaagaacaaataccgaaaaatatactcctttactcttgaacctcgaacaattgaa
gattttgagtctgtgaatacataccttcagatatctccaacatctgtgtttacaagcaag
tcattctgttccttgcagacctctgaaggggttcactgtttagtgggctgcacccttacc
tataggaaattcaattttaagggcaatatggatttgatagagtttaagatactgaatgag
gaagaagtagaaaaaaatctgaaaaatatatttaatatttccttggaaagaaagcttgtt
cccaaacatggtgatcaattttttaccatttag

DBGET integrated database retrieval system