KEGG   Ailuropoda melanoleuca (giant panda): 100480641Help
Entry
100480641         CDS       T01329                                 

Gene name
ATP1A2
Definition
(RefSeq) ATPase Na+/K+ transporting subunit alpha 2
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04260  Cardiac muscle contraction
aml04261  Adrenergic signaling in cardiomyocytes
aml04911  Insulin secretion
aml04918  Thyroid hormone synthesis
aml04919  Thyroid hormone signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04960  Aldosterone-regulated sodium reabsorption
aml04961  Endocrine and other factor-regulated calcium reabsorption
aml04964  Proximal tubule bicarbonate reclamation
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04972  Pancreatic secretion
aml04973  Carbohydrate digestion and absorption
aml04974  Protein digestion and absorption
aml04976  Bile secretion
aml04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100480641 (ATP1A2)
   04022 cGMP-PKG signaling pathway
    100480641 (ATP1A2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100480641 (ATP1A2)
   04918 Thyroid hormone synthesis
    100480641 (ATP1A2)
   04919 Thyroid hormone signaling pathway
    100480641 (ATP1A2)
   04925 Aldosterone synthesis and secretion
    100480641 (ATP1A2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100480641 (ATP1A2)
   04261 Adrenergic signaling in cardiomyocytes
    100480641 (ATP1A2)
  09154 Digestive system
   04970 Salivary secretion
    100480641 (ATP1A2)
   04971 Gastric acid secretion
    100480641 (ATP1A2)
   04972 Pancreatic secretion
    100480641 (ATP1A2)
   04976 Bile secretion
    100480641 (ATP1A2)
   04973 Carbohydrate digestion and absorption
    100480641 (ATP1A2)
   04974 Protein digestion and absorption
    100480641 (ATP1A2)
   04978 Mineral absorption
    100480641 (ATP1A2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100480641 (ATP1A2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100480641 (ATP1A2)
   04964 Proximal tubule bicarbonate reclamation
    100480641 (ATP1A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100480641 (ATP1A2)
Enzymes [BR:aml01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     100480641 (ATP1A2)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100480641 (ATP1A2)
  Exosomal proteins of other body fluids (saliva and urine)
   100480641 (ATP1A2)
  Exosomal proteins of colorectal cancer cells
   100480641 (ATP1A2)
  Exosomal proteins of bladder cancer cells
   100480641 (ATP1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 100480641
NCBI-ProteinID: XP_019648317
Ensembl: ENSAMEG00000013987
Position
Un
AA seq 1039 aa AA seqDB search
MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKG
LTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAME
DEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVVREGEKMQINA
EEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFL
GVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPF
NSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYM
ELGGLGERVLGFCQLNLPSGKFPRGFRFDTDELNFPTEKLCFVGLMSMIDPPRXXXXXXX
XXXXXXXXXRPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDI
AARLNIPLSQVNPRDAKACVVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVEG
CQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEE
GRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAY
EAAESDIMKRQPRNPQTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLL
GIRLDWDDRSMNDLEDSYGQEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSV
FQQGMKNKILIFGLLEETALAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEV
RKLILRRYPGGWVEKETYY
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtggggccggccgcgagtactcgcctgcagccaccactgcggagaatgggggc
ggcaagaagaagcagaaagagaaggaactggatgagctgaagaaggaggtggccatggat
gaccacaagctgtccttggatgagctgggccgcaagtaccaagtggacctctccaagggc
ctcaccaaccagcgggcccaggacattctggctcgggatgggcccaatgccctcaccccg
cccccgacaacccccgagtgggtcaagttctgtcgccagctcttcgggggcttctccatc
ctgctgtggatcggggccatcctctgcttcctggcctacggcatccaggctgccatggag
gacgagccatccaatgacaacctctatctgggcgtggtgctggcggctgtggtcatcgtc
accggctgcttctcctactaccaggaggccaagagctccaagatcatggattccttcaag
aacatggtgcctcagcaagcccttgtggtgcgggaaggagagaagatgcagatcaacgcg
gaggaggtggtggtgggagacctggtggaggtgaagggtggggaccgtgtgcctgcagac
ctccgcatcatctcttctcatggctgcaaggtggataactcatcgctcacgggcgagtcg
gagccccagacccgctcccccgagttcacccacgagaaccccctggagacccgcaacatc
tgcttcttctccaccaactgcgtggaaggcacggccaggggcatcgtgattgccacaggc
gaccggacggtgatggggcgcatagccaccctggcctcgggcctggaggtggggcggacg
cccatcgccatggagatcgagcacttcatccagctgatcacaggggtggccgtgttcctg
ggggtctctttcttcgtgctctccctcatcctgggctacagctggctggaggctgtcatc
ttcctcatcggcatcatcgtggccaatgtgcctgaggggctgctggccactgtcaccgtg
tgtctgaccctgacggccaagcgcatggcccggaagaactgcctggtgaagaatctggag
gcagtggagacgctgggctccacctccaccatctgctccgacaagaccggcaccctcacc
cagaaccgcatgactgtcgcccacatgtggttcgacaaccagatccacgaagctgacacc
actgaggatcagtctggggccacttttgacaaacgatcccccacgtggacggccctgtct
cggatcgctggtctctgcaaccgcgctgtcttcaaggccgggcaggagaacatctctgtg
tctaagcgggacacagctggcgacgcctcggagtcagctctgctcaagtgtattgagctg
tcctgcggctccgtgaggaagatgagggacagaaaccccaaggtggcggagatccctttc
aattccaccaacaagtaccagctgtccatccacgagcgagaagacagtccccagagccac
gtgctggtgatgaagggggccccggagcgcatcctggaccggtgctccaccatcttggtg
cagggcaaggagatccctctggacaaggagatgcaagatgccttccagaacgcctacatg
gagctgggcgggctgggggagcgcgtgctggggttttgtcaactgaatctgccctctggg
aagtttccccggggcttcaggtttgacacggatgagctgaactttcccacggagaagctc
tgcttcgtggggctcatgtccatgatcgaccctccccgnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnncgtccccgggctgccgtaccggacgccgtgggc
aagtgccgcagcgccggcatcaaggtgatcatggtgaccggggaccaccccatcacagcc
aaggccattgccaaaggtgtgggcattatatccgaaggcaacgagacagtggaggacatt
gcggcccggctcaacattcctctcagccaggtcaaccccagggacgccaaggcgtgcgtg
gtgcacggctcagacctgaaggacatgacgtcggagcagctggatgagatcctgaagaac
cacacggagatcgtgttcgcgcggacgtccccgcagcagaagctcatcattgtggagggc
tgccagaggcagggggccatcgtggcagtgaccggggacggcgtgaacgactcccccgcg
ctgaagaaggccgacatcggcatcgccatgggcatctcgggctccgacgtgtcgaagcag
gcggccgacatgatcctcctggacgacaacttcgcctccatcgtcacaggcgtggaggaa
ggccgcctcatctttgacaacctgaagaaatccatcgcgtacaccctgaccagcaacatc
cccgagatcacccccttcctgcttttcatcatcgccaacatccccttgcctctgggcacc
gtgaccatcctctgcatcgacctgggcacggacatggtccccgccatctccttggcctac
gaggccgcggagagtgacatcatgaagcggcagccgaggaacccccagacggacaagctg
gtgaatgagagactcatcagcatggcctatggacagatcgggatgatccaggcgctgggt
ggcttcttcacctacttcgtcatcctggcggagaacggcttcctgccgtcgcggctgctg
gggatccgcctggactgggacgaccggtccatgaacgatctggaggacagctacgggcag
gagtggacctacgagcagcgcaaggtggtggagttcacctgccacacggccttcttcgcc
agcatcgtggtcgtgcagtgggccgacctcatcatctgcaagacccgacgcaactcagtc
ttccaacagggcatgaagaacaagattctgatttttgggctgctggaggagacagcgctg
gcagccttcctgtcctactgcccgggcatgggcgtggccctccgcatgtacccgctcaag
gtcacctggtggttctgcgcctttccctacagcctcctcatcttcatctatgatgaggtc
cggaagctcatcctgaggcggtaccccggaggctgggtggagaaggagacgtactactga

DBGET integrated database retrieval system