KEGG   Ailuropoda melanoleuca (giant panda): 100480690Help
Entry
100480690         CDS       T01329                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7 like 1
  KO
K04490  transcription factor 7-like 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04520  Adherens junction
aml04916  Melanogenesis
aml04934  Cushing's syndrome
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05213  Endometrial cancer
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05217  Basal cell carcinoma
aml05221  Acute myeloid leukemia
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Module
aml_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100480690 (TCF7L1)
   04390 Hippo signaling pathway
    100480690 (TCF7L1)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    100480690 (TCF7L1)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100480690 (TCF7L1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100480690 (TCF7L1)
   05210 Colorectal cancer
    100480690 (TCF7L1)
   05225 Hepatocellular carcinoma
    100480690 (TCF7L1)
   05226 Gastric cancer
    100480690 (TCF7L1)
   05216 Thyroid cancer
    100480690 (TCF7L1)
   05221 Acute myeloid leukemia
    100480690 (TCF7L1)
   05217 Basal cell carcinoma
    100480690 (TCF7L1)
   05215 Prostate cancer
    100480690 (TCF7L1)
   05213 Endometrial cancer
    100480690 (TCF7L1)
   05224 Breast cancer
    100480690 (TCF7L1)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100480690 (TCF7L1)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100480690 (TCF7L1)
  Infectious diseases
   05165 Human papillomavirus infection
    100480690 (TCF7L1)
Transcription factors [BR:aml03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100480690 (TCF7L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 100480690
NCBI-ProteinID: XP_011227742
Position
Un
AA seq 769 aa AA seqDB search
MRPLGSRRQLASLHSTAARCPGHLLSGPPARRHPVGLRTQGADVLLTLLWPPVYVPSCRN
PWVLSVGKSQVGGSVAAGPAAAATVLTVPLATTLRTTSSLTDLVRNYGAKVIFGISAAGD
FRHLNKVKNLGEGGGALEPHRKEECKAARHIPGCHKFVRSSLSYASREGEKAGGIPCSEE
LQAASVRGRVCVSEAFPQGAVPPASAPLRWEGVWKRNDELIPFQDEGGEEQEPSSDSASA
QRDLDEVKSSLVNESENQSSSSDSEAERPQPARDAFQKPRDYFTEVRRPQDGAFFKGPPY
PGYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKV
PVVQPPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPG
AVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPG
LPASGIPHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKE
MRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNY
GKKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKSCDSPASSHGSMLDSP
ATPSAALASPAAPAATHSEQAQPLSLTTKPESRAQLALHSAAFLSAKATATSSGQMGSQP
PLLSRPLPLGSLPTALLTSPPSFPAALHAHQALPVLQAQPLSLVTKSAH
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgctgggctccaggcgacagctggcgtctctgcacagcacggcggctcgctgc
ccgggccatctgctctcgggacccccagctcggcgtcatcctgtgggactccggacacag
ggagctgatgtcctgctgactttgctttggccgcctgtgtacgtaccatcctgtcggaac
ccgtgggtgctcagcgtggggaagagccaggtcgggggaagcgtggccgccggcccagcc
gcagcagcgacagtcctcacggtcccgctggccaccacactgcggactacgagttcgttg
actgacctggtccggaactacggggcaaaggtgatctttgggatttcagcggcgggtgac
tttagacacctgaacaaggtcaaaaacctgggcgagggaggaggcgcgttggaaccccac
aggaaggaggagtgcaaggccgcccggcatattccagggtgccataaatttgtccgatcc
tctctgtcctacgcatcccgcgagggagagaaggctggcgggatcccgtgctccgaggaa
ctccaggcagcgagtgtccgcggccgggtctgtgtgtccgaagctttcccgcagggggca
gtgccgcccgccagcgcgccgctgcggtgggagggggtgtggaagcggaacgacgaactg
atccctttccaagacgaggggggcgaggagcaggagccgagcagcgacagtgcctccgcg
cagcgggacctggacgaggtcaagtcgtccctggtcaacgagtcggagaaccaaagcagc
agctcggactcggaggcggagcgcccgcagcccgcccgggacgccttccagaagccgcgg
gactatttcaccgaagtgagaaggccccaggacggcgcgttctttaagggccccccgtac
cctgggtacccgttcctgatgatcccggacttgagcagtccgtacctctccaacggaccc
ttgtctcccggaggagcgcgcacgtacctgcagatgaaatggcccctcctcgatgtcccc
tctagcgccacagtcaaggacaccaggtcaccgtccccagcacacttgtctaataaagtt
cctgttgttcagcccccgcatcacatgcacccgttgacgcccctcatcacctacagcaac
gaccacttctcccctggctcccctcccacgcacctctccccagagatcgatccaaagaca
ggaatcccccggccccctcacccatctgagctgtctccgtattacccactgtctcctgga
gctgtcggacaaatcccccatcccctcggctggctcgtcccacagcaaggacagcccatg
tactccctccctcctggtggtttccggcacccctaccctgccctcgccatgaacgcctca
atgtccagcctggtttccagtcggttctctcctcacatggtggctccggcccatcctggt
ctgcccgcctcagggattccccaccccgccattgtctcccccatcgtcaagcaggagcca
gcgccccccagcctcagcccggccgtgagcgcgaaatcaccagtcacggtgaaaaaggag
gaagaaaagaaaccccacgtgaagaagcctctgaatgccttcatgttgtatatgaaggag
atgagggccaaggtggtagccgagtgcaccctgaaggaaagcgcggccattaaccaaatc
ctggggagaaagtggcacaacctgtcccgagaagaacaggccaagtactatgaactggcc
cggaaggagcggcagctgcattcccagctctacccgacctggtcagcccgggacaactat
ggtaagaaaaagaagaggaagagagaaaagcagctgtcacagacacagtcccagcagcaa
gtccaagaggcagagggtgctctggcctccaaaagcaagaagccatgtgttcagtacctg
ccccctgagaagtcctgtgacagccctgcctcttcccacggcagcatgctggactccccg
gccaccccctccgcagccttggcgtccccggctgcccccgcggcgacccactcggagcaa
gcccagcccctctccctcaccaccaagccggagagccgggcccagctggctttacactcg
gctgccttcctgtcggccaaggcgacagccacctcctctggccagatgggcagccagccc
ccgctcctctcccggccactccccctcgggtccctgcccacagctctgctgacttctccc
ccctccttcccggccgcgctccatgcccaccaggccctcccagtcctccaggcccagcct
ctttccttggtcaccaagtctgcccactga

DBGET integrated database retrieval system