KEGG   Ailuropoda melanoleuca (giant panda): 100480860Help
Entry
100480860         CDS       T01329                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 1
  KO
K05197  glutamate receptor 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04024  cAMP signaling pathway
aml04080  Neuroactive ligand-receptor interaction
aml04713  Circadian entrainment
aml04720  Long-term potentiation
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04728  Dopaminergic synapse
aml04730  Long-term depression
aml05014  Amyotrophic lateral sclerosis (ALS)
aml05031  Amphetamine addiction
aml05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100480860 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100480860 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100480860 (GRIA1)
   04728 Dopaminergic synapse
    100480860 (GRIA1)
   04720 Long-term potentiation
    100480860 (GRIA1)
   04730 Long-term depression
    100480860 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    100480860 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100480860 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100480860 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    100480860 (GRIA1)
   05033 Nicotine addiction
    100480860 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aml04040]
    100480860 (GRIA1)
Ion channels [BR:aml04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100480860 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 100480860
NCBI-ProteinID: XP_002923642
Ensembl: ENSAMEG00000014413
UniProt: G1M786
Position
Un
AA seq 906 aa AA seqDB search
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGTSGGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccggtttcctaggcgcggtagtaggtgccaat
ttccccaacaatatccagatcgggggattatttccaaaccagcagtcacaggaacatgcc
gcttttagatttgctttgtcacaactcacagagcccccaaagctgctcccccagattgat
attgtgaacatcagcgacagctttgagatgacctatagattctgttcccagttctccaaa
ggagtctacgccatctttgggttttatgaacggagaactgtcaacatgctgacctccttc
tgtggggccctccatgtctgcttcattacaccgagttttcctgttgacacctccaatcag
tttgtccttcagctgcgccctgagctgcaggatgctcttatcagcatcatcgaccattac
aagtggcagaaatttgtctacatttatgatgcggaccggggtctgtccgtcctgcagaaa
gtcctggacacagctgctgagaagaactggcaggtgacagcagtcaacattttgaccacc
acagaggagggataccggatgctctttcaggacctggaaaagaaaaaggagcggctagtg
gtggtggactgtgaatcagaacgcctcaatgccatcttgggccagatcataaagctggag
aaaaacggcatcggctaccactacatccttgcaaatctgggtttcatggatattgactta
aacaaattcaaggagagtggagcaaatgtgacaggtttccagttggtgaactacacagac
accatcccagccaagatcatgcagcagtggaagaacagcgacgctcgagaccacacccgg
gtagactggaagagacctaagtacacctctgcactcacctacgacggggtgaaggtgatg
gctgaggcttttcagagcctgcggaggcagagaatcgatatatcccgccgagggaatgct
ggggactgcctggctaaccccgctgtgccgtggggccaggggattgacatccagagagct
ctgcagcaggtgcggtttgaaggcttgacaggaaacgtgcagtttaatgagaagggacgc
cggaccaactacaccctccatgtgattgaaatgaaacatgatggcatccgaaagattggt
tactggaatgaagatgataagtttgtccctgcagccaccgatgctcaagccgggggggac
aattcaagtgtccagaataggacatacatcgtcactacaatcctggaagatccttatgtg
atgctcaagaagaatgccaaccagtttgagggcaatgaccggtacgagggctactgtgta
gagctggcagcagagattgccaagcatgtgggctactcctaccgtcttgagattgtcagc
gatggaaaatatggagcccgtgaccctgacaccaaggcttggaatggcatggtgggagag
ctggtctatggaagagccgatgtggccgtagctcctttaactatcaccttggtccgggaa
gaggtgatagatttctccaagccatttatgagtttggggatctccatcatgataaaaaag
ccacagaagtccaaacctggggtcttctccttcctcgatcctttggcttatgagatttgg
atgtgcattgtctttgcctacattggagtgagtgtcgtccttttcctggtcagccgcttc
agcccctatgaatggcacagtgaagagtttgaggaagggcgggaccagacaaccagtgac
caatccaatgagtttgggatattcaacagtctgtggttctccctgggagcattcatgcaa
caaggatgtgacatttctcccaggtccctgtctggccgcatcgttggtggtgtctggtgg
ttcttcaccttgatcatcatctcctcatacacagccaacctggctgccttcctgaccgtg
gaaaggatggtgtctcccatcgagagtgccgaggacctagcaaagcagacggaaatcgct
tatgggaccctggaagcagggtccacgaaggagttcttcaggaggtctaaaattgctgtg
tttgagaagatgtggacatacatgaagtcagcagagccgtcagtttttgtgaggaccaca
gaggagggaatgatccgagtgaggaaatccaaaggcaaatacgcctaccttctggaatct
accatgaatgagtacattgagcagcggaaaccctgtgacaccatgaaggtgggaggtaac
ttggattccaaaggctatggcattgcaacgcccaaggggtccgccctgagaaatccagta
aacctggcagtgttaaaactgaacgagcaggggcttttggacaaattgaaaaacaaatgg
tggtacgacaaaggagagtgcggcagcgggggcggtgactccaaggacaagacaagtgcc
ctgagcctcagcaatgtggcaggcgtgttctacatcctgatcggaggacttggactagcc
atgctggttgccttaatcgagttctgctacaaatcccgtagtgaatccaagcggatgaag
ggtttctgtttgatcccacagcaatccatcaatgaagccatacggacatcgacgctccca
cgtaacagtggggcaggaaccagcggtggtggtagtggagaaaacggccgggtagtcagc
catgacttccccaagtccatgcagtcaattccctgcatgagccacagttcagggatgccc
ttgggagccacgggattgtaa

DBGET integrated database retrieval system