KEGG   Ailuropoda melanoleuca (giant panda): 100480951Help
Entry
100480951         CDS       T01329                                 

Gene name
MYL10
Definition
(RefSeq) myosin light chain 10
  KO
K12756  myosin regulatory light chain 10
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04510  Focal adhesion
aml04670  Leukocyte transendothelial migration
aml04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100480951 (MYL10)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100480951 (MYL10)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100480951 (MYL10)
Cytoskeleton proteins [BR:aml04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100480951 (MYL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_7 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 100480951
NCBI-ProteinID: XP_011231382
Ensembl: ENSAMEG00000015356
Position
Un
AA seq 180 aa AA seqDB search
MTGGFCSTPPGTSQAPRRARKRAEGGASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDK
EDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVF
DTEGKGFVKADFIKEKLMTQADRFSEDEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgacagggggcttctgcagtaccccacctggcacttcccaggcccccagaagagcccgc
aagagagcagaaggtggcgccagctccaatgtcttctccatgttcgatcagtcccagatc
caggagtttaaagaggccttcaccatcatggaccagaaccgggatggcttcatcgacaag
gaggacctgcgggacacctttgctgccttgggccgcatcaatgtgaagaacgaggagctg
gaggccatggtgaaggaggcccctgggcccatcaacttcaccgtcttcctgaccatgttt
ggggagaagctgaagggtacagacccggaggagaccattctccatgccttcaaagtcttt
gacaccgaagggaaaggttttgtcaaggctgatttcatcaaagagaagctcatgacccag
gcagaccggttcagcgaggacgaggtcaagcagatgtttgcggctttcccgccagacgtg
tgtggcaacctggattaccggaacctatgctacgtcatcacgcacggagaagagaaggat
tag

DBGET integrated database retrieval system