KEGG   Ailuropoda melanoleuca (giant panda): 100481084Help
Entry
100481084         CDS       T01329                                 

Gene name
UGT1A6
Definition
(RefSeq) UDP-glucuronosyltransferase 1-6
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00040  Pentose and glucuronate interconversions
aml00053  Ascorbate and aldarate metabolism
aml00140  Steroid hormone biosynthesis
aml00830  Retinol metabolism
aml00860  Porphyrin and chlorophyll metabolism
aml00980  Metabolism of xenobiotics by cytochrome P450
aml00982  Drug metabolism - cytochrome P450
aml00983  Drug metabolism - other enzymes
aml01100  Metabolic pathways
aml05204  Chemical carcinogenesis
Module
aml_M00014  Glucuronate pathway (uronate pathway)
aml_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100481084 (UGT1A6)
   00053 Ascorbate and aldarate metabolism
    100481084 (UGT1A6)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100481084 (UGT1A6)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100481084 (UGT1A6)
   00860 Porphyrin and chlorophyll metabolism
    100481084 (UGT1A6)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100481084 (UGT1A6)
   00982 Drug metabolism - cytochrome P450
    100481084 (UGT1A6)
   00983 Drug metabolism - other enzymes
    100481084 (UGT1A6)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100481084 (UGT1A6)
Enzymes [BR:aml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100481084 (UGT1A6)
Glycosyltransferases [BR:aml01003]
 Others
  Hydrophobic molecule
   100481084 (UGT1A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C DUF4514
Motif
Other DBs
NCBI-GeneID: 100481084
NCBI-ProteinID: XP_002917996
Ensembl: ENSAMEG00000016164
UniProt: G1MCM1
Position
Un
AA seq 528 aa AA seqDB search
MACLLHVFQKVFFLVLWGEVVGDKLLVVPQDGSHWLSMKDIVELLSEKGHDIVVLVPEVN
LLLKESKHYARKIYPVPYDQEELQNRYRSFGNNHFAERWLLNAAQTEYRNNMIVIDMYFT
NCQSLLEDTATLSVLRESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEHTMSR
SPNPVSYIPRCYTQFSDQMTFPQRVANYLVNYLETYLFYCLYSKYEDLASNILKRDVHLP
TLYRKSSIWLLRYDFVFEYPRPVMPNMVFIGGTNCKKKGVLSQEFEAYVNASGEHGIVVF
SLGSMVSEIPEKKAMEIADALGKIPQTVLWRYTGTPPPNLAKNTRLVKWLPQNDLLGHPK
TRAFITHSGSHGIYEGICNGVPMVMLPLFGDQMDNAKRMETRGAGVTLNVLEMTSEDLAN
ALKTVINDKSYKENIMRLSSLHKDRPIEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQ
YHSLDVIGFLLAVVLGAVFIAYKCCVLGCRKCFGKKGRVKKSHKSKAH
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcctcctccatgtgtttcagaaagttttcttcttagtgctctggggggaggtt
gtaggggacaagctgctggtggtcccccaggatggaagccactggctcagtatgaaggac
atagttgagctcctcagtgagaaggggcatgacattgtggtgctcgtgccagaagtcaat
ttgcttctgaaggaatccaagcactacgcaagaaagatctacccagtgccgtacgaccag
gaagagctgcagaatcgttaccgctcttttggaaacaatcactttgctgagagatggctc
ctgaacgcggctcagacggagtacaggaataacatgattgttattgacatgtacttcacc
aactgccagagcctcctggaggacacggccaccctgagcgtcctccgggagagcaagttc
gatgcccttttcacagacccggccctaccctgcggggtgatcctggccgagtacctgggc
ctgccctccgtgtacctcttcaggggcttcccatgctccctggagcatacgatgagcagg
agcccgaaccccgtgtcctacattcccagatgctacactcaattctcagaccagatgacg
ttcccccaacgggtggccaactacctcgttaattacttggagacctatctgttctactgt
ctgtattccaagtatgaagaccttgcctccaatatcctcaagagagatgtgcacttaccc
accttgtatcggaagagctccatttggctgttaaggtacgactttgtgtttgagtatccc
agaccagtcatgcccaacatggttttcattggagggaccaactgcaagaagaagggagtc
ctgtctcaggaatttgaagcctacgttaatgcttccggagaacatggaattgtggttttc
tccttgggctccatggtctcagagattcctgagaagaaagctatggaaattgctgatgct
ttgggaaaaatacctcagacagtcctgtggcggtacactggcactccaccaccgaatctt
gcgaagaacacaagactcgtcaagtggctgccccagaacgacctgcttggtcacccgaag
actcgtgcctttatcacacattctggctcccacggcatatacgaggggatttgcaacggc
gttccaatggtgatgttgcccttgtttggcgatcagatggacaatgcgaagcgcatggag
accaggggggctggagtgaccttgaacgtcctggaaatgacgtctgaagatttagcaaat
gccctaaaaactgtcatcaatgacaaaagctataaggaaaacattatgcgcctctccagc
ctgcacaaggaccgccccatcgagcccctggacctggctgtgttctgggtggagttcgtg
atgaggcacaagggggctccgcacctgcgccccgcagcccatgatctcacctggtaccag
taccactctttggacgtgatcggcttcctcctggccgttgtgctgggggctgtcttcatc
gcttacaagtgttgtgtcttgggctgccggaagtgctttgggaagaaaggacgagtgaag
aaatctcacaaatccaaggcacactga

DBGET integrated database retrieval system